BLASTX nr result
ID: Glycyrrhiza32_contig00015599
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00015599 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006592067.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 101 3e-24 XP_006592066.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 101 4e-24 XP_019464888.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 100 5e-24 XP_019464886.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 100 8e-24 XP_014519677.1 PREDICTED: thaumatin-like protein 1b [Vigna radia... 99 2e-23 XP_017432262.1 PREDICTED: thaumatin-like protein 1b [Vigna angul... 99 2e-23 KYP68341.1 Thaumatin-like protein 1 [Cajanus cajan] 99 4e-23 OIV99557.1 hypothetical protein TanjilG_17367 [Lupinus angustifo... 100 6e-23 XP_007131694.1 hypothetical protein PHAVU_011G034100g [Phaseolus... 98 6e-23 XP_003538984.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 97 8e-23 GAU30621.1 hypothetical protein TSUD_62410 [Trifolium subterraneum] 97 9e-23 XP_006590848.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 97 1e-22 XP_004505778.1 PREDICTED: thaumatin-like protein 1b [Cicer ariet... 97 2e-22 XP_015951861.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 94 2e-21 XP_015951860.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 94 3e-21 XP_013456481.1 pathogenesis-related thaumatin family protein [Me... 93 3e-21 XP_013456480.1 pathogenesis-related thaumatin family protein [Me... 93 6e-21 XP_016186843.1 PREDICTED: thaumatin-like protein 1b isoform X2 [... 91 4e-20 KDO68002.1 hypothetical protein CISIN_1g021236mg [Citrus sinensis] 90 4e-20 XP_016186842.1 PREDICTED: thaumatin-like protein 1b isoform X1 [... 91 5e-20 >XP_006592067.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Glycine max] KRH24285.1 hypothetical protein GLYMA_12G031000 [Glycine max] Length = 287 Score = 101 bits (251), Expect = 3e-24 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGF L SGKSRTI PKSW Sbjct: 21 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFTLESGKSRTIKIPKSW 71 >XP_006592066.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Glycine max] KRH24286.1 hypothetical protein GLYMA_12G031000 [Glycine max] Length = 312 Score = 101 bits (251), Expect = 4e-24 Identities = 47/51 (92%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGF L SGKSRTI PKSW Sbjct: 21 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFTLESGKSRTIKIPKSW 71 >XP_019464888.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Lupinus angustifolius] Length = 287 Score = 100 bits (249), Expect = 5e-24 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQS SFKIVNKCRHTIWPGLLSGATSPPLPTTGFAL SGKS+TI PKSW Sbjct: 21 EVQSTSFKIVNKCRHTIWPGLLSGATSPPLPTTGFALNSGKSKTIKIPKSW 71 >XP_019464886.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Lupinus angustifolius] Length = 312 Score = 100 bits (249), Expect = 8e-24 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQS SFKIVNKCRHTIWPGLLSGATSPPLPTTGFAL SGKS+TI PKSW Sbjct: 21 EVQSTSFKIVNKCRHTIWPGLLSGATSPPLPTTGFALNSGKSKTIKIPKSW 71 >XP_014519677.1 PREDICTED: thaumatin-like protein 1b [Vigna radiata var. radiata] Length = 310 Score = 99.4 bits (246), Expect = 2e-23 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFAL SG+S+T+ PKSW Sbjct: 21 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALLSGESKTLKIPKSW 71 >XP_017432262.1 PREDICTED: thaumatin-like protein 1b [Vigna angularis] KOM51014.1 hypothetical protein LR48_Vigan08g184100 [Vigna angularis] BAT91053.1 hypothetical protein VIGAN_06235700 [Vigna angularis var. angularis] Length = 310 Score = 99.4 bits (246), Expect = 2e-23 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFAL SG+S+T+ PKSW Sbjct: 21 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALLSGESKTLKIPKSW 71 >KYP68341.1 Thaumatin-like protein 1 [Cajanus cajan] Length = 306 Score = 98.6 bits (244), Expect = 4e-23 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASFKIVNKCRHTIWPGLLSGA+SPPLPTTGF L SGKS+TI PKSW Sbjct: 21 EVQSASFKIVNKCRHTIWPGLLSGASSPPLPTTGFTLKSGKSKTITIPKSW 71 >OIV99557.1 hypothetical protein TanjilG_17367 [Lupinus angustifolius] Length = 609 Score = 100 bits (249), Expect = 6e-23 Identities = 46/51 (90%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQS SFKIVNKCRHTIWPGLLSGATSPPLPTTGFAL SGKS+TI PKSW Sbjct: 21 EVQSTSFKIVNKCRHTIWPGLLSGATSPPLPTTGFALNSGKSKTIKIPKSW 71 Score = 58.9 bits (141), Expect = 2e-08 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = +2 Query: 92 VQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 V +A+F VN+C +T+WPG+L+ A SPPL +TGF L SRT P +W Sbjct: 287 VIAATFTFVNRCDYTVWPGILANAGSPPLDSTGFELPKLTSRTFQPPTAW 336 >XP_007131694.1 hypothetical protein PHAVU_011G034100g [Phaseolus vulgaris] ESW03688.1 hypothetical protein PHAVU_011G034100g [Phaseolus vulgaris] Length = 310 Score = 98.2 bits (243), Expect = 6e-23 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASF+IVNKCRHTIWPGLLSGATSPPLPTTGFAL SG+S+T+ PKSW Sbjct: 21 EVQSASFRIVNKCRHTIWPGLLSGATSPPLPTTGFALQSGESKTLKIPKSW 71 >XP_003538984.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Glycine max] XP_006590849.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Glycine max] KRH29263.1 hypothetical protein GLYMA_11G106100 [Glycine max] KRH29264.1 hypothetical protein GLYMA_11G106100 [Glycine max] Length = 287 Score = 97.4 bits (241), Expect = 8e-23 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 +VQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGF L SGKSR + PKSW Sbjct: 21 DVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFTLESGKSRIVKIPKSW 71 >GAU30621.1 hypothetical protein TSUD_62410 [Trifolium subterraneum] Length = 259 Score = 96.7 bits (239), Expect = 9e-23 Identities = 44/51 (86%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASFKIVN+CR+TIWPGLLSGATSPPLPTTGF L SGKSRTI P+SW Sbjct: 21 EVQSASFKIVNRCRYTIWPGLLSGATSPPLPTTGFTLKSGKSRTIQIPRSW 71 >XP_006590848.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Glycine max] KRH29265.1 hypothetical protein GLYMA_11G106100 [Glycine max] KRH29266.1 hypothetical protein GLYMA_11G106100 [Glycine max] Length = 312 Score = 97.4 bits (241), Expect = 1e-22 Identities = 44/51 (86%), Positives = 46/51 (90%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 +VQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGF L SGKSR + PKSW Sbjct: 21 DVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFTLESGKSRIVKIPKSW 71 >XP_004505778.1 PREDICTED: thaumatin-like protein 1b [Cicer arietinum] Length = 287 Score = 96.7 bits (239), Expect = 2e-22 Identities = 45/51 (88%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 +V SASFKIVNKCR+TIWPGLLSGATSP LPTTGFAL SGKSRTIN PKSW Sbjct: 21 DVHSASFKIVNKCRYTIWPGLLSGATSPALPTTGFALKSGKSRTINIPKSW 71 >XP_015951861.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Arachis duranensis] Length = 293 Score = 94.0 bits (232), Expect = 2e-21 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASF+++NKCRH IWPGLLSGATSPPLPTTGF L++G+SRTI P+SW Sbjct: 21 EVQSASFRVINKCRHPIWPGLLSGATSPPLPTTGFLLSAGRSRTITIPRSW 71 >XP_015951860.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Arachis duranensis] Length = 320 Score = 94.0 bits (232), Expect = 3e-21 Identities = 40/51 (78%), Positives = 47/51 (92%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQSASF+++NKCRH IWPGLLSGATSPPLPTTGF L++G+SRTI P+SW Sbjct: 21 EVQSASFRVINKCRHPIWPGLLSGATSPPLPTTGFLLSAGRSRTITIPRSW 71 >XP_013456481.1 pathogenesis-related thaumatin family protein [Medicago truncatula] KEH30512.1 pathogenesis-related thaumatin family protein [Medicago truncatula] Length = 290 Score = 93.2 bits (230), Expect = 3e-21 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQ+ SFKIVNKCR+TIWPGLLSGATSPPLPTTGF L SG SRTI PK+W Sbjct: 21 EVQTTSFKIVNKCRYTIWPGLLSGATSPPLPTTGFTLKSGNSRTIQIPKAW 71 >XP_013456480.1 pathogenesis-related thaumatin family protein [Medicago truncatula] KEH30511.1 pathogenesis-related thaumatin family protein [Medicago truncatula] Length = 326 Score = 93.2 bits (230), Expect = 6e-21 Identities = 42/51 (82%), Positives = 45/51 (88%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EVQ+ SFKIVNKCR+TIWPGLLSGATSPPLPTTGF L SG SRTI PK+W Sbjct: 21 EVQTTSFKIVNKCRYTIWPGLLSGATSPPLPTTGFTLKSGNSRTIQIPKAW 71 >XP_016186843.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Arachis ipaensis] XP_016186844.1 PREDICTED: thaumatin-like protein 1b isoform X2 [Arachis ipaensis] Length = 293 Score = 90.5 bits (223), Expect = 4e-20 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EV+SA F+++NKCRH IWPGLLSGATSPPLPTTGF L +G+SRTI P+SW Sbjct: 21 EVESARFRVINKCRHPIWPGLLSGATSPPLPTTGFLLNAGRSRTITIPRSW 71 >KDO68002.1 hypothetical protein CISIN_1g021236mg [Citrus sinensis] Length = 253 Score = 89.7 bits (221), Expect = 4e-20 Identities = 40/51 (78%), Positives = 43/51 (84%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 E + ASFK+VNKCR T+WPGLLSGA SPPLPTTGF L SGKSRTI PKSW Sbjct: 22 ETEPASFKMVNKCRRTVWPGLLSGANSPPLPTTGFELKSGKSRTITIPKSW 72 >XP_016186842.1 PREDICTED: thaumatin-like protein 1b isoform X1 [Arachis ipaensis] Length = 320 Score = 90.5 bits (223), Expect = 5e-20 Identities = 38/51 (74%), Positives = 45/51 (88%) Frame = +2 Query: 89 EVQSASFKIVNKCRHTIWPGLLSGATSPPLPTTGFALTSGKSRTINAPKSW 241 EV+SA F+++NKCRH IWPGLLSGATSPPLPTTGF L +G+SRTI P+SW Sbjct: 21 EVESARFRVINKCRHPIWPGLLSGATSPPLPTTGFLLNAGRSRTITIPRSW 71