BLASTX nr result
ID: Glycyrrhiza32_contig00015447
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00015447 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003552121.1 PREDICTED: small ubiquitin-related modifier 1-lik... 70 2e-13 AGV54400.1 small ubiquitin-related modifier 2-like protein [Phas... 70 3e-13 KYP34154.1 Ubiquitin-like protein SMT3 [Cajanus cajan] 64 3e-11 XP_007140637.1 hypothetical protein PHAVU_008G129000g [Phaseolus... 64 4e-11 NP_001235592.1 uncharacterized protein LOC100305708 [Glycine max... 64 4e-11 KRH46678.1 hypothetical protein GLYMA_08G350600 [Glycine max] 64 5e-11 XP_014497136.1 PREDICTED: small ubiquitin-related modifier 2-lik... 61 3e-10 XP_019450742.1 PREDICTED: small ubiquitin-related modifier 2-lik... 60 6e-10 XP_011009710.1 PREDICTED: small ubiquitin-related modifier 1-lik... 59 4e-09 XP_002321284.1 hypothetical protein POPTR_0014s18990g [Populus t... 59 4e-09 BAD43861.1 ubiquitin-like protein SMT3-like, partial [Arabidopsi... 56 6e-09 XP_010929803.1 PREDICTED: small ubiquitin-related modifier 2 [El... 58 7e-09 AFK35187.1 unknown [Lotus japonicus] AFK42686.1 unknown [Lotus j... 57 1e-08 XP_019193527.1 PREDICTED: small ubiquitin-related modifier 1-lik... 57 1e-08 XP_012085087.1 PREDICTED: small ubiquitin-related modifier 1 [Ja... 57 2e-08 XP_008794940.1 PREDICTED: small ubiquitin-related modifier 2-lik... 57 2e-08 OAY32799.1 hypothetical protein MANES_13G046700 [Manihot esculenta] 57 2e-08 XP_018847733.1 PREDICTED: small ubiquitin-related modifier 1-lik... 57 2e-08 XP_018818051.1 PREDICTED: small ubiquitin-related modifier 1-lik... 57 2e-08 XP_002521079.1 PREDICTED: small ubiquitin-related modifier 1 [Ri... 57 2e-08 >XP_003552121.1 PREDICTED: small ubiquitin-related modifier 1-like [Glycine max] KHN10571.1 Small ubiquitin-related modifier 2 [Glycine soja] KRG99710.1 hypothetical protein GLYMA_18G165200 [Glycine max] Length = 114 Score = 69.7 bits (169), Expect = 2e-13 Identities = 34/40 (85%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL*IYVD-LHQKA 165 EQTPDELEMEDGDEIDAMLHQTGGGH+FL +Y D LHQ A Sbjct: 75 EQTPDELEMEDGDEIDAMLHQTGGGHKFLQMYDDHLHQNA 114 >AGV54400.1 small ubiquitin-related modifier 2-like protein [Phaseolus vulgaris] Length = 128 Score = 69.7 bits (169), Expect = 3e-13 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL*IYVDLHQKA*ESKW 150 EQTPDELEMEDGDEIDAMLHQTGGGH+FL ++V L K +W Sbjct: 75 EQTPDELEMEDGDEIDAMLHQTGGGHKFLRMHVHLFWKCLRKQW 118 >KYP34154.1 Ubiquitin-like protein SMT3 [Cajanus cajan] Length = 108 Score = 63.9 bits (154), Expect = 3e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDELEMEDGDEIDAMLHQTGGGH+FL Sbjct: 80 EQTPDELEMEDGDEIDAMLHQTGGGHEFL 108 >XP_007140637.1 hypothetical protein PHAVU_008G129000g [Phaseolus vulgaris] ESW12631.1 hypothetical protein PHAVU_008G129000g [Phaseolus vulgaris] Length = 103 Score = 63.5 bits (153), Expect = 4e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDELEMEDGDEIDAMLHQTGGGH+FL Sbjct: 75 EQTPDELEMEDGDEIDAMLHQTGGGHKFL 103 >NP_001235592.1 uncharacterized protein LOC100305708 [Glycine max] ACU13530.1 unknown [Glycine max] KHN10987.1 Small ubiquitin-related modifier 2 [Glycine soja] KRH46679.1 hypothetical protein GLYMA_08G350600 [Glycine max] Length = 103 Score = 63.5 bits (153), Expect = 4e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDELEMEDGDEIDAMLHQTGGGH+FL Sbjct: 75 EQTPDELEMEDGDEIDAMLHQTGGGHKFL 103 >KRH46678.1 hypothetical protein GLYMA_08G350600 [Glycine max] Length = 117 Score = 63.5 bits (153), Expect = 5e-11 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDELEMEDGDEIDAMLHQTGGGH+FL Sbjct: 89 EQTPDELEMEDGDEIDAMLHQTGGGHKFL 117 >XP_014497136.1 PREDICTED: small ubiquitin-related modifier 2-like [Vigna radiata var. radiata] XP_017417703.1 PREDICTED: small ubiquitin-related modifier 2-like [Vigna angularis] KOM37877.1 hypothetical protein LR48_Vigan03g125900 [Vigna angularis] BAT84324.1 hypothetical protein VIGAN_04165900 [Vigna angularis var. angularis] Length = 103 Score = 61.2 bits (147), Expect = 3e-10 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDELEMEDGDEIDAMLHQTGGG++FL Sbjct: 75 EQTPDELEMEDGDEIDAMLHQTGGGYKFL 103 >XP_019450742.1 PREDICTED: small ubiquitin-related modifier 2-like [Lupinus angustifolius] XP_019450743.1 PREDICTED: small ubiquitin-related modifier 2-like [Lupinus angustifolius] OIW07542.1 hypothetical protein TanjilG_08429 [Lupinus angustifolius] OIW07543.1 hypothetical protein TanjilG_08430 [Lupinus angustifolius] Length = 102 Score = 60.5 bits (145), Expect = 6e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDELEMEDGDEIDAMLHQTGGG+ FL Sbjct: 74 EQTPDELEMEDGDEIDAMLHQTGGGNHFL 102 >XP_011009710.1 PREDICTED: small ubiquitin-related modifier 1-like [Populus euphratica] Length = 108 Score = 58.5 bits (140), Expect = 4e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDEL+MEDGDEIDAMLHQTGGGH L Sbjct: 79 EQTPDELDMEDGDEIDAMLHQTGGGHASL 107 >XP_002321284.1 hypothetical protein POPTR_0014s18990g [Populus trichocarpa] ABK95530.1 unknown [Populus trichocarpa] EEE99599.1 hypothetical protein POPTR_0014s18990g [Populus trichocarpa] Length = 108 Score = 58.5 bits (140), Expect = 4e-09 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDEL+MEDGDEIDAMLHQTGGGH L Sbjct: 79 EQTPDELDMEDGDEIDAMLHQTGGGHASL 107 >BAD43861.1 ubiquitin-like protein SMT3-like, partial [Arabidopsis thaliana] Length = 36 Score = 56.2 bits (134), Expect = 6e-09 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGG 207 EQTPDELEMEDGDEIDAMLHQTGGG Sbjct: 2 EQTPDELEMEDGDEIDAMLHQTGGG 26 >XP_010929803.1 PREDICTED: small ubiquitin-related modifier 2 [Elaeis guineensis] Length = 102 Score = 57.8 bits (138), Expect = 7e-09 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL*IY 186 EQTPDELEMEDGDEIDAMLHQTGGG + + I+ Sbjct: 71 EQTPDELEMEDGDEIDAMLHQTGGGMEIVDIF 102 >AFK35187.1 unknown [Lotus japonicus] AFK42686.1 unknown [Lotus japonicus] Length = 103 Score = 57.4 bits (137), Expect = 1e-08 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQ 201 EQTPDELEMEDGDEIDAMLHQTGGG Q Sbjct: 75 EQTPDELEMEDGDEIDAMLHQTGGGAQ 101 >XP_019193527.1 PREDICTED: small ubiquitin-related modifier 1-like [Ipomoea nil] Length = 102 Score = 57.0 bits (136), Expect = 1e-08 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGH 204 EQTPDELEMEDGDEIDAMLHQTGG H Sbjct: 77 EQTPDELEMEDGDEIDAMLHQTGGNH 102 >XP_012085087.1 PREDICTED: small ubiquitin-related modifier 1 [Jatropha curcas] KDP26374.1 hypothetical protein JCGZ_17532 [Jatropha curcas] Length = 109 Score = 57.0 bits (136), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQF 198 EQTPDELEMEDGDEIDAMLHQTGGG+ + Sbjct: 81 EQTPDELEMEDGDEIDAMLHQTGGGNVY 108 >XP_008794940.1 PREDICTED: small ubiquitin-related modifier 2-like [Phoenix dactylifera] Length = 102 Score = 56.6 bits (135), Expect = 2e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL*IY 186 EQTPDELEMEDGDEIDAMLHQTGGG + + I+ Sbjct: 71 EQTPDELEMEDGDEIDAMLHQTGGGMENVDIF 102 >OAY32799.1 hypothetical protein MANES_13G046700 [Manihot esculenta] Length = 118 Score = 57.0 bits (136), Expect = 2e-08 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQF 198 EQTPDELEMEDGDEIDAMLHQTGGG+ + Sbjct: 90 EQTPDELEMEDGDEIDAMLHQTGGGNVY 117 >XP_018847733.1 PREDICTED: small ubiquitin-related modifier 1-like [Juglans regia] Length = 103 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGH 204 EQTPDELEMEDGDEIDAMLHQTGGG+ Sbjct: 76 EQTPDELEMEDGDEIDAMLHQTGGGN 101 >XP_018818051.1 PREDICTED: small ubiquitin-related modifier 1-like [Juglans regia] Length = 107 Score = 56.6 bits (135), Expect = 2e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGH 204 EQTPDELEMEDGDEIDAMLHQTGGG+ Sbjct: 80 EQTPDELEMEDGDEIDAMLHQTGGGN 105 >XP_002521079.1 PREDICTED: small ubiquitin-related modifier 1 [Ricinus communis] EEF41230.1 conserved hypothetical protein [Ricinus communis] Length = 108 Score = 56.6 bits (135), Expect = 2e-08 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = -2 Query: 281 EQTPDELEMEDGDEIDAMLHQTGGGHQFL 195 EQTPDELEMEDGDEIDAMLHQTGGG L Sbjct: 80 EQTPDELEMEDGDEIDAMLHQTGGGDAHL 108