BLASTX nr result
ID: Glycyrrhiza32_contig00015404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00015404 (205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012573510.1 PREDICTED: zinc finger BED domain-containing prot... 76 2e-14 XP_012573509.1 PREDICTED: zinc finger BED domain-containing prot... 76 2e-14 KHN15062.1 hypothetical protein glysoja_011680 [Glycine soja] 74 2e-14 XP_016199355.1 PREDICTED: zinc finger BED domain-containing prot... 75 2e-14 XP_015935840.1 PREDICTED: zinc finger BED domain-containing prot... 74 6e-14 XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus... 74 8e-14 KRH03660.1 hypothetical protein GLYMA_17G111700 [Glycine max] 74 1e-13 XP_019452720.1 PREDICTED: zinc finger BED domain-containing prot... 73 1e-13 XP_019452712.1 PREDICTED: zinc finger BED domain-containing prot... 73 1e-13 XP_019452679.1 PREDICTED: zinc finger BED domain-containing prot... 73 1e-13 XP_014621068.1 PREDICTED: zinc finger BED domain-containing prot... 73 1e-13 KHN03605.1 Putative AC transposase [Glycine soja] 72 4e-13 XP_014625130.1 PREDICTED: zinc finger BED domain-containing prot... 70 1e-12 KHN15060.1 Putative AC transposase [Glycine soja] 70 1e-12 XP_014621065.1 PREDICTED: zinc finger BED domain-containing prot... 70 1e-12 XP_017437935.1 PREDICTED: zinc finger BED domain-containing prot... 70 2e-12 XP_014494010.1 PREDICTED: zinc finger BED domain-containing prot... 70 2e-12 XP_014494008.1 PREDICTED: zinc finger BED domain-containing prot... 70 2e-12 XP_004493926.1 PREDICTED: zinc finger BED domain-containing prot... 68 8e-12 XP_017422057.1 PREDICTED: zinc finger BED domain-containing prot... 68 1e-11 >XP_012573510.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573511.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] XP_012573512.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Cicer arietinum] Length = 1058 Score = 75.9 bits (185), Expect = 2e-14 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP + LP SEPLADSH+ D+KP+PH HL +YDT+PNNHLDH Sbjct: 287 ESLPDCDPLPCSEPLADSHIRDIKPMPHDHLAQYDTVPNNHLDH 330 >XP_012573509.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X1 [Cicer arietinum] Length = 1066 Score = 75.9 bits (185), Expect = 2e-14 Identities = 31/44 (70%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP + LP SEPLADSH+ D+KP+PH HL +YDT+PNNHLDH Sbjct: 295 ESLPDCDPLPCSEPLADSHIRDIKPMPHDHLAQYDTVPNNHLDH 338 >KHN15062.1 hypothetical protein glysoja_011680 [Glycine soja] Length = 210 Score = 73.6 bits (179), Expect = 2e-14 Identities = 31/51 (60%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +1 Query: 55 HSDEMIESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNN-HLDH 204 H +ESLP+++ LP SEP+ D HLTD+KP+PH+HL +YDTLPNN H+DH Sbjct: 81 HMIPELESLPNSDPLPSSEPMQDIHLTDIKPLPHNHLAQYDTLPNNHHMDH 131 >XP_016199355.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis ipaensis] XP_016199363.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis ipaensis] Length = 1077 Score = 75.5 bits (184), Expect = 2e-14 Identities = 32/44 (72%), Positives = 35/44 (79%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 E LPH+E LP SEPL+DSHL D+KPIP HL YDTLPNNHL H Sbjct: 306 EPLPHSEPLPSSEPLSDSHLADIKPIPEDHLAHYDTLPNNHLHH 349 >XP_015935840.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis duranensis] XP_015935843.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER [Arachis duranensis] Length = 1088 Score = 74.3 bits (181), Expect = 6e-14 Identities = 31/44 (70%), Positives = 35/44 (79%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 E LPH+E LP +EPL+DSHL D+KPIP HL YDTLPNNHL H Sbjct: 317 EPLPHSEPLPSNEPLSDSHLADIKPIPEDHLAHYDTLPNNHLHH 360 >XP_007155048.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] ESW27042.1 hypothetical protein PHAVU_003G168600g [Phaseolus vulgaris] Length = 1252 Score = 73.9 bits (180), Expect = 8e-14 Identities = 30/44 (68%), Positives = 38/44 (86%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 E LP+++SLP SEPL DSHL D+KPIPH+HL +YDTLPN+H+ H Sbjct: 480 EPLPNSDSLPTSEPLPDSHLIDIKPIPHNHLAQYDTLPNSHMHH 523 >KRH03660.1 hypothetical protein GLYMA_17G111700 [Glycine max] Length = 494 Score = 73.6 bits (179), Expect = 1e-13 Identities = 31/51 (60%), Positives = 41/51 (80%), Gaps = 1/51 (1%) Frame = +1 Query: 55 HSDEMIESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNN-HLDH 204 H +ESLP+++ LP SEP+ D HLTD+KP+PH+HL +YDTLPNN H+DH Sbjct: 272 HMIPELESLPNSDPLPSSEPMQDIHLTDIKPLPHNHLAQYDTLPNNHHMDH 322 >XP_019452720.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X3 [Lupinus angustifolius] Length = 920 Score = 73.2 bits (178), Expect = 1e-13 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP+ E LP SEP ADSHLTD+KPIPH+HL +YD P+NHLDH Sbjct: 151 ESLPNFEPLPCSEPPADSHLTDIKPIPHNHLSQYDIPPSNHLDH 194 >XP_019452712.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X2 [Lupinus angustifolius] Length = 921 Score = 73.2 bits (178), Expect = 1e-13 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP+ E LP SEP ADSHLTD+KPIPH+HL +YD P+NHLDH Sbjct: 152 ESLPNFEPLPCSEPPADSHLTDIKPIPHNHLSQYDIPPSNHLDH 195 >XP_019452679.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452687.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452695.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] XP_019452705.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Lupinus angustifolius] Length = 943 Score = 73.2 bits (178), Expect = 1e-13 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP+ E LP SEP ADSHLTD+KPIPH+HL +YD P+NHLDH Sbjct: 174 ESLPNFEPLPCSEPPADSHLTDIKPIPHNHLSQYDIPPSNHLDH 217 >XP_014621068.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20149.1 hypothetical protein GLYMA_13G159800 [Glycine max] Length = 1100 Score = 73.2 bits (178), Expect = 1e-13 Identities = 29/50 (58%), Positives = 39/50 (78%) Frame = +1 Query: 55 HSDEMIESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 H +ESLP+++ +P SEP+ D HLTD+KP+PH+HL YDTL NNH+DH Sbjct: 319 HMIPELESLPNSDPVPSSEPMPDIHLTDIKPLPHNHLAHYDTLSNNHMDH 368 >KHN03605.1 Putative AC transposase [Glycine soja] Length = 1180 Score = 72.0 bits (175), Expect = 4e-13 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP+++ +P SEP+ D HLTD+KP+PH+HL YDTL NNH+DH Sbjct: 405 ESLPNSDPVPSSEPMPDIHLTDIKPLPHNHLAHYDTLSNNHMDH 448 >XP_014625130.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014625131.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH03658.1 hypothetical protein GLYMA_17G111500 [Glycine max] Length = 1154 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/45 (64%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLP-NNHLDH 204 ESLP+++ LP SEP+ D HLTD+KP+PH+HL +YDTLP N+H+DH Sbjct: 378 ESLPNSDPLPSSEPMQDIHLTDIKPLPHNHLAQYDTLPSNHHMDH 422 >KHN15060.1 Putative AC transposase [Glycine soja] Length = 1154 Score = 70.5 bits (171), Expect = 1e-12 Identities = 29/45 (64%), Positives = 39/45 (86%), Gaps = 1/45 (2%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLP-NNHLDH 204 ESLP+++ LP SEP+ D HLTD+KP+PH+HL +YDTLP N+H+DH Sbjct: 378 ESLPNSDPLPSSEPMQDIHLTDIKPLPHNHLAQYDTLPSNHHMDH 422 >XP_014621065.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621066.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] XP_014621067.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Glycine max] KRH20154.1 hypothetical protein GLYMA_13G160000 [Glycine max] Length = 1180 Score = 70.5 bits (171), Expect = 1e-12 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP+++ +P SEP+ D HLTD+KP+PH+HL YD+L NNH+DH Sbjct: 405 ESLPNSDPVPSSEPMPDIHLTDIKPLPHNHLAHYDSLSNNHMDH 448 >XP_017437935.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Vigna angularis] KOM33000.1 hypothetical protein LR48_Vigan01g255600 [Vigna angularis] BAT76315.1 hypothetical protein VIGAN_01429700 [Vigna angularis var. angularis] Length = 1231 Score = 70.1 bits (170), Expect = 2e-12 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP+++ LP SE L DSHLTD+KPI H+HL +YDTLPN+H+ H Sbjct: 456 ESLPNSDPLPASESLPDSHLTDIKPISHNHLAQYDTLPNSHMHH 499 >XP_014494010.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X2 [Vigna radiata var. radiata] Length = 853 Score = 69.7 bits (169), Expect = 2e-12 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLPH+E LP SEPL D HLTD+K + H+HL Y+TLPNNH +H Sbjct: 79 ESLPHSELLPNSEPLVDDHLTDIKVLYHNHLTHYETLPNNHSNH 122 >XP_014494008.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Vigna radiata var. radiata] XP_014494009.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like isoform X1 [Vigna radiata var. radiata] Length = 1047 Score = 69.7 bits (169), Expect = 2e-12 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLPH+E LP SEPL D HLTD+K + H+HL Y+TLPNNH +H Sbjct: 273 ESLPHSELLPNSEPLVDDHLTDIKVLYHNHLTHYETLPNNHSNH 316 >XP_004493926.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_004493927.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_012569418.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] XP_012569419.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER-like [Cicer arietinum] Length = 1274 Score = 68.2 bits (165), Expect = 8e-12 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLP +ES P SEP+ADSH TDVKP+PH+HL EY LPN+HLDH Sbjct: 502 ESLPISESPPSSEPMADSHNTDVKPMPHNHLQEY--LPNSHLDH 543 >XP_017422057.1 PREDICTED: zinc finger BED domain-containing protein DAYSLEEPER isoform X2 [Vigna angularis] Length = 853 Score = 67.8 bits (164), Expect = 1e-11 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +1 Query: 73 ESLPHAESLPRSEPLADSHLTDVKPIPHSHLPEYDTLPNNHLDH 204 ESLPH+E LP SEPL D HLTD+K + H+HL Y+ LPNNH +H Sbjct: 79 ESLPHSELLPNSEPLVDDHLTDIKVLYHNHLTHYEALPNNHSNH 122