BLASTX nr result
ID: Glycyrrhiza32_contig00015333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00015333 (444 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP68047.1 Isoleucyl-tRNA synthetase, cytoplasmic [Cajanus cajan] 94 2e-19 KOM51124.1 hypothetical protein LR48_Vigan08g195100 [Vigna angul... 94 2e-19 XP_017433055.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [... 94 2e-19 XP_014493910.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [... 94 2e-19 XP_004505648.1 PREDICTED: probable isoleucine--tRNA ligase, cyto... 94 2e-19 XP_003540296.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic-l... 94 2e-19 GAU39886.1 hypothetical protein TSUD_397230 [Trifolium subterran... 94 2e-19 XP_015883795.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [... 92 5e-19 XP_007132212.1 hypothetical protein PHAVU_011G075600g [Phaseolus... 91 1e-18 JAU04582.1 putative isoleucine--tRNA ligase, cytoplasmic, partia... 88 1e-18 XP_015964560.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [... 91 2e-18 XP_010097489.1 Isoleucine--tRNA ligase [Morus notabilis] EXB6868... 91 2e-18 XP_003607351.2 isoleucine-tRNA ligase [Medicago truncatula] AES8... 91 2e-18 XP_003537737.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic-l... 91 2e-18 XP_016199288.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic-l... 91 2e-18 XP_004296724.1 PREDICTED: LOW QUALITY PROTEIN: probable isoleuci... 90 3e-18 XP_011026380.1 PREDICTED: probable isoleucine--tRNA ligase, cyto... 89 6e-18 XP_013743474.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [... 89 6e-18 XP_013636548.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [... 89 6e-18 XP_009140128.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [... 89 6e-18 >KYP68047.1 Isoleucyl-tRNA synthetase, cytoplasmic [Cajanus cajan] Length = 1060 Score = 93.6 bits (231), Expect = 2e-19 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR HSMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYHSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >KOM51124.1 hypothetical protein LR48_Vigan08g195100 [Vigna angularis] Length = 1154 Score = 93.6 bits (231), Expect = 2e-19 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR HSMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYHSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_017433055.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Vigna angularis] BAT91166.1 hypothetical protein VIGAN_06247800 [Vigna angularis var. angularis] Length = 1181 Score = 93.6 bits (231), Expect = 2e-19 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR HSMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYHSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_014493910.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Vigna radiata var. radiata] Length = 1181 Score = 93.6 bits (231), Expect = 2e-19 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR HSMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYHSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_004505648.1 PREDICTED: probable isoleucine--tRNA ligase, cytoplasmic [Cicer arietinum] Length = 1182 Score = 93.6 bits (231), Expect = 2e-19 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR HSMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYHSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_003540296.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic-like [Glycine max] KRH24084.1 hypothetical protein GLYMA_12G020700 [Glycine max] Length = 1182 Score = 93.6 bits (231), Expect = 2e-19 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR HSMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYHSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >GAU39886.1 hypothetical protein TSUD_397230 [Trifolium subterraneum] Length = 1202 Score = 93.6 bits (231), Expect = 2e-19 Identities = 41/44 (93%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR HSMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYHSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_015883795.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Ziziphus jujuba] Length = 1199 Score = 92.4 bits (228), Expect = 5e-19 Identities = 40/44 (90%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR H+MTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYHTMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_007132212.1 hypothetical protein PHAVU_011G075600g [Phaseolus vulgaris] ESW04206.1 hypothetical protein PHAVU_011G075600g [Phaseolus vulgaris] Length = 400 Score = 90.5 bits (223), Expect = 1e-18 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR SMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >JAU04582.1 putative isoleucine--tRNA ligase, cytoplasmic, partial [Noccaea caerulescens] Length = 241 Score = 88.2 bits (217), Expect = 1e-18 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR +MTGHHVTRRFGWDCHGLPVENEID+K Sbjct: 59 YGHILAGTIKDIVTRYQTMTGHHVTRRFGWDCHGLPVENEIDRK 102 >XP_015964560.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Arachis duranensis] Length = 1160 Score = 90.5 bits (223), Expect = 2e-18 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR SMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_010097489.1 Isoleucine--tRNA ligase [Morus notabilis] EXB68680.1 Isoleucine--tRNA ligase [Morus notabilis] Length = 1169 Score = 90.5 bits (223), Expect = 2e-18 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI D+VTR H+MTGHHVTRRFGWDCHGLPVENEID+K Sbjct: 57 YGHILAGTIKDVVTRFHAMTGHHVTRRFGWDCHGLPVENEIDRK 100 >XP_003607351.2 isoleucine-tRNA ligase [Medicago truncatula] AES89548.2 isoleucine-tRNA ligase [Medicago truncatula] Length = 1179 Score = 90.5 bits (223), Expect = 2e-18 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR SMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_003537737.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic-like [Glycine max] KHN05507.1 Isoleucine--tRNA ligase, cytoplasmic [Glycine soja] KRH29053.1 hypothetical protein GLYMA_11G094300 [Glycine max] Length = 1182 Score = 90.5 bits (223), Expect = 2e-18 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR SMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_016199288.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic-like [Arachis ipaensis] Length = 1184 Score = 90.5 bits (223), Expect = 2e-18 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR SMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_004296724.1 PREDICTED: LOW QUALITY PROTEIN: probable isoleucine--tRNA ligase, cytoplasmic [Fragaria vesca subsp. vesca] Length = 1186 Score = 90.1 bits (222), Expect = 3e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DI+TR SMTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIITRYQSMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_011026380.1 PREDICTED: probable isoleucine--tRNA ligase, cytoplasmic isoform X2 [Populus euphratica] XP_011014398.1 PREDICTED: probable isoleucine--tRNA ligase, cytoplasmic isoform X2 [Populus euphratica] Length = 984 Score = 89.4 bits (220), Expect = 6e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR +MTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQTMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_013743474.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Brassica napus] Length = 1175 Score = 89.4 bits (220), Expect = 6e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR +MTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQTMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_013636548.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Brassica oleracea var. oleracea] Length = 1175 Score = 89.4 bits (220), Expect = 6e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR +MTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQTMTGHHVTRRFGWDCHGLPVENEIDKK 100 >XP_009140128.1 PREDICTED: isoleucine--tRNA ligase, cytoplasmic [Brassica rapa] Length = 1175 Score = 89.4 bits (220), Expect = 6e-18 Identities = 39/44 (88%), Positives = 41/44 (93%) Frame = +2 Query: 311 HGHILAGTINDIVTRNHSMTGHHVTRRFGWDCHGLPVENEIDKK 442 +GHILAGTI DIVTR +MTGHHVTRRFGWDCHGLPVENEIDKK Sbjct: 57 YGHILAGTIKDIVTRYQTMTGHHVTRRFGWDCHGLPVENEIDKK 100