BLASTX nr result
ID: Glycyrrhiza32_contig00015191
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00015191 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KNE89549.1 hypothetical protein PSTG_16994 [Puccinia striiformis... 58 7e-09 >KNE89549.1 hypothetical protein PSTG_16994 [Puccinia striiformis f. sp. tritici PST-78] Length = 125 Score = 57.8 bits (138), Expect = 7e-09 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -3 Query: 242 TGLRSIARNNKATRLLTRPG*TTKSSAKDSILRTVQL 132 TGLRS ARNNKATRLLTRPG T+KSSAKDS R V+L Sbjct: 11 TGLRSAARNNKATRLLTRPGYTSKSSAKDSSQRAVKL 47