BLASTX nr result
ID: Glycyrrhiza32_contig00014463
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00014463 (268 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_173498.1 hypothetical protein NitaMp161 [Nicotiana tabacum] B... 75 3e-15 OIT03997.1 hypothetical protein A4A49_64303 [Nicotiana attenuata] 52 9e-07 OIS97329.1 hypothetical protein A4A49_60634 [Nicotiana attenuata] 52 9e-07 OIT25104.1 hypothetical protein A4A49_56994 [Nicotiana attenuata] 52 2e-06 OIT34735.1 hypothetical protein A4A49_61171 [Nicotiana attenuata] 50 7e-06 OIT18708.1 hypothetical protein A4A49_54492 [Nicotiana attenuata] 50 7e-06 >YP_173498.1 hypothetical protein NitaMp161 [Nicotiana tabacum] BAD83564.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 134 Score = 74.7 bits (182), Expect = 3e-15 Identities = 46/89 (51%), Positives = 52/89 (58%), Gaps = 7/89 (7%) Frame = +1 Query: 4 FLSVTLNFFQFLDNRSRIMLAPGANPI---AYFLAW-LSGS*IRSIE*NSKTICY*LLLP 171 F VT FQFLDN SRIMLA GANPI + W L+ + LLLP Sbjct: 46 FRRVTPTIFQFLDNHSRIMLAAGANPIFAHTSLVVWELNQKHRMKGSFQDHLLLNQLLLP 105 Query: 172 GKVLSFPCSP---WVWKLIPWMDHNNYKG 249 G++LSFPCSP + KLIPWMDHN YKG Sbjct: 106 GEILSFPCSPRDFTLGKLIPWMDHNLYKG 134 >OIT03997.1 hypothetical protein A4A49_64303 [Nicotiana attenuata] Length = 109 Score = 52.4 bits (124), Expect = 9e-07 Identities = 24/33 (72%), Positives = 27/33 (81%), Gaps = 3/33 (9%) Frame = +1 Query: 160 LLLPGKVLSFPCSP---WVWKLIPWMDHNNYKG 249 LLLPG++LSFPCSP + KLIPWMDHN YKG Sbjct: 77 LLLPGEILSFPCSPRDLTLGKLIPWMDHNLYKG 109 >OIS97329.1 hypothetical protein A4A49_60634 [Nicotiana attenuata] Length = 109 Score = 52.4 bits (124), Expect = 9e-07 Identities = 24/33 (72%), Positives = 27/33 (81%), Gaps = 3/33 (9%) Frame = +1 Query: 160 LLLPGKVLSFPCSP---WVWKLIPWMDHNNYKG 249 LLLPG++LSFPCSP + KLIPWMDHN YKG Sbjct: 77 LLLPGEILSFPCSPRDLTLGKLIPWMDHNLYKG 109 >OIT25104.1 hypothetical protein A4A49_56994 [Nicotiana attenuata] Length = 109 Score = 51.6 bits (122), Expect = 2e-06 Identities = 24/33 (72%), Positives = 27/33 (81%), Gaps = 3/33 (9%) Frame = +1 Query: 160 LLLPGKVLSFPCSPW---VWKLIPWMDHNNYKG 249 LLLPG++LSFPCSP + KLIPWMDHN YKG Sbjct: 77 LLLPGEMLSFPCSPQDLTLGKLIPWMDHNLYKG 109 >OIT34735.1 hypothetical protein A4A49_61171 [Nicotiana attenuata] Length = 109 Score = 50.1 bits (118), Expect = 7e-06 Identities = 23/33 (69%), Positives = 26/33 (78%), Gaps = 3/33 (9%) Frame = +1 Query: 160 LLLPGKVLSFPCSP---WVWKLIPWMDHNNYKG 249 LLLP ++LSFPCSP + KLIPWMDHN YKG Sbjct: 77 LLLPSEILSFPCSPRDLTLGKLIPWMDHNLYKG 109 >OIT18708.1 hypothetical protein A4A49_54492 [Nicotiana attenuata] Length = 109 Score = 50.1 bits (118), Expect = 7e-06 Identities = 23/33 (69%), Positives = 26/33 (78%), Gaps = 3/33 (9%) Frame = +1 Query: 160 LLLPGKVLSFPCSP---WVWKLIPWMDHNNYKG 249 LLLP ++LSFPCSP + KLIPWMDHN YKG Sbjct: 77 LLLPSEILSFPCSPRDLTLGKLIPWMDHNLYKG 109