BLASTX nr result
ID: Glycyrrhiza32_contig00014231
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00014231 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012572714.1 PREDICTED: nucleolin 1 isoform X2 [Cicer arietinum] 135 1e-35 XP_004505720.1 PREDICTED: nucleolin 2 isoform X1 [Cicer arietinum] 135 1e-35 XP_014494302.1 PREDICTED: nucleolin 1 isoform X2 [Vigna radiata ... 133 2e-34 XP_014494301.1 PREDICTED: nucleolin 1 isoform X1 [Vigna radiata ... 133 2e-34 XP_007131647.1 hypothetical protein PHAVU_011G030600g [Phaseolus... 132 2e-34 XP_019413228.1 PREDICTED: nucleolin 1-like isoform X11 [Lupinus ... 130 6e-34 XP_006592048.1 PREDICTED: nucleolin 1 isoform X3 [Glycine max] 130 8e-34 KHN32280.1 RNA-binding protein 34 [Glycine soja] 131 9e-34 XP_003537777.1 PREDICTED: nucleolin 1-like [Glycine max] KRH2916... 131 1e-33 XP_019413227.1 PREDICTED: nucleolin 1-like isoform X10 [Lupinus ... 130 1e-33 XP_019413226.1 PREDICTED: nucleolin 1-like isoform X9 [Lupinus a... 130 1e-33 XP_019413225.1 PREDICTED: nucleolin 1-like isoform X8 [Lupinus a... 130 1e-33 XP_019413224.1 PREDICTED: nucleolin 1-like isoform X7 [Lupinus a... 130 1e-33 XP_019413223.1 PREDICTED: nucleolin 1-like isoform X6 [Lupinus a... 130 1e-33 XP_019413222.1 PREDICTED: nucleolin 1-like isoform X5 [Lupinus a... 130 1e-33 XP_019413221.1 PREDICTED: nucleolin 2-like isoform X4 [Lupinus a... 130 1e-33 XP_006592047.1 PREDICTED: nucleolin 1 isoform X2 [Glycine max] 130 1e-33 XP_019413220.1 PREDICTED: nucleolin 2-like isoform X3 [Lupinus a... 130 1e-33 XP_019413219.1 PREDICTED: nucleolin 2-like isoform X2 [Lupinus a... 130 1e-33 XP_019413218.1 PREDICTED: nucleolin 2-like isoform X1 [Lupinus a... 130 1e-33 >XP_012572714.1 PREDICTED: nucleolin 1 isoform X2 [Cicer arietinum] Length = 573 Score = 135 bits (341), Expect = 1e-35 Identities = 64/74 (86%), Positives = 70/74 (94%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIRASLEEHF SCGE+TRVSIPKDYDSG VKGFAY+DFKDSDS KALELHES+LGGY Sbjct: 430 EDEIRASLEEHFSSCGEITRVSIPKDYDSGYVKGFAYMDFKDSDSLGKALELHESELGGY 489 Query: 70 TLSVDEAKPRDNSQ 29 TLSVDEAKPR+++Q Sbjct: 490 TLSVDEAKPRESNQ 503 >XP_004505720.1 PREDICTED: nucleolin 2 isoform X1 [Cicer arietinum] Length = 615 Score = 135 bits (341), Expect = 1e-35 Identities = 64/74 (86%), Positives = 70/74 (94%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIRASLEEHF SCGE+TRVSIPKDYDSG VKGFAY+DFKDSDS KALELHES+LGGY Sbjct: 472 EDEIRASLEEHFSSCGEITRVSIPKDYDSGYVKGFAYMDFKDSDSLGKALELHESELGGY 531 Query: 70 TLSVDEAKPRDNSQ 29 TLSVDEAKPR+++Q Sbjct: 532 TLSVDEAKPRESNQ 545 >XP_014494302.1 PREDICTED: nucleolin 1 isoform X2 [Vigna radiata var. radiata] Length = 708 Score = 133 bits (334), Expect = 2e-34 Identities = 61/72 (84%), Positives = 70/72 (97%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIRASLEEHFGSCGE+TRVSIPKDY++GAVKGFAY+DF DSDS +KALELHE++LGGY Sbjct: 551 EDEIRASLEEHFGSCGEITRVSIPKDYETGAVKGFAYLDFGDSDSISKALELHETELGGY 610 Query: 70 TLSVDEAKPRDN 35 TL+VDEAKP+DN Sbjct: 611 TLTVDEAKPKDN 622 >XP_014494301.1 PREDICTED: nucleolin 1 isoform X1 [Vigna radiata var. radiata] Length = 747 Score = 133 bits (334), Expect = 2e-34 Identities = 61/72 (84%), Positives = 70/72 (97%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIRASLEEHFGSCGE+TRVSIPKDY++GAVKGFAY+DF DSDS +KALELHE++LGGY Sbjct: 590 EDEIRASLEEHFGSCGEITRVSIPKDYETGAVKGFAYLDFGDSDSISKALELHETELGGY 649 Query: 70 TLSVDEAKPRDN 35 TL+VDEAKP+DN Sbjct: 650 TLTVDEAKPKDN 661 >XP_007131647.1 hypothetical protein PHAVU_011G030600g [Phaseolus vulgaris] ESW03641.1 hypothetical protein PHAVU_011G030600g [Phaseolus vulgaris] Length = 693 Score = 132 bits (333), Expect = 2e-34 Identities = 61/72 (84%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIR+SLEEHFGSCGEVTRVSIPKDY++GAVKGFAY+DF D+D +KALELHE++LGGY Sbjct: 544 EDEIRSSLEEHFGSCGEVTRVSIPKDYETGAVKGFAYMDFSDADGISKALELHETELGGY 603 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRDN Sbjct: 604 TLSVDEAKPRDN 615 >XP_019413228.1 PREDICTED: nucleolin 1-like isoform X11 [Lupinus angustifolius] Length = 552 Score = 130 bits (328), Expect = 6e-34 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 407 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 466 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 467 TLSVDEAKPRDS 478 >XP_006592048.1 PREDICTED: nucleolin 1 isoform X3 [Glycine max] Length = 585 Score = 130 bits (328), Expect = 8e-34 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIR SL+EHFGSCG++TRVSIPKDY+SGAVKGFAYVDF D DS KALELHE++LGGY Sbjct: 428 EDEIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGY 487 Query: 70 TLSVDEAKPRDN 35 TL+VDEAKPRDN Sbjct: 488 TLTVDEAKPRDN 499 >KHN32280.1 RNA-binding protein 34 [Glycine soja] Length = 735 Score = 131 bits (329), Expect = 9e-34 Identities = 60/72 (83%), Positives = 68/72 (94%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIR SL+EHFGSCG++TRVSIPKDY+SGAVKGFAYVDF D+DS KALELHE++LGGY Sbjct: 592 EDEIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFGDADSMGKALELHETELGGY 651 Query: 70 TLSVDEAKPRDN 35 TL+VDEAKPRDN Sbjct: 652 TLTVDEAKPRDN 663 >XP_003537777.1 PREDICTED: nucleolin 1-like [Glycine max] KRH29160.1 hypothetical protein GLYMA_11G101500 [Glycine max] Length = 748 Score = 131 bits (329), Expect = 1e-33 Identities = 60/72 (83%), Positives = 68/72 (94%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIR SL+EHFGSCG++TRVSIPKDY+SGAVKGFAYVDF D+DS KALELHE++LGGY Sbjct: 592 EDEIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFGDADSMGKALELHETELGGY 651 Query: 70 TLSVDEAKPRDN 35 TL+VDEAKPRDN Sbjct: 652 TLTVDEAKPRDN 663 >XP_019413227.1 PREDICTED: nucleolin 1-like isoform X10 [Lupinus angustifolius] Length = 636 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 491 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 550 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 551 TLSVDEAKPRDS 562 >XP_019413226.1 PREDICTED: nucleolin 1-like isoform X9 [Lupinus angustifolius] Length = 638 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 493 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 552 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 553 TLSVDEAKPRDS 564 >XP_019413225.1 PREDICTED: nucleolin 1-like isoform X8 [Lupinus angustifolius] Length = 638 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 493 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 552 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 553 TLSVDEAKPRDS 564 >XP_019413224.1 PREDICTED: nucleolin 1-like isoform X7 [Lupinus angustifolius] Length = 639 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 494 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 553 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 554 TLSVDEAKPRDS 565 >XP_019413223.1 PREDICTED: nucleolin 1-like isoform X6 [Lupinus angustifolius] Length = 642 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 497 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 556 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 557 TLSVDEAKPRDS 568 >XP_019413222.1 PREDICTED: nucleolin 1-like isoform X5 [Lupinus angustifolius] Length = 647 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 502 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 561 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 562 TLSVDEAKPRDS 573 >XP_019413221.1 PREDICTED: nucleolin 2-like isoform X4 [Lupinus angustifolius] OIV99588.1 hypothetical protein TanjilG_17398 [Lupinus angustifolius] Length = 657 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 512 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 571 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 572 TLSVDEAKPRDS 583 >XP_006592047.1 PREDICTED: nucleolin 1 isoform X2 [Glycine max] Length = 666 Score = 130 bits (328), Expect = 1e-33 Identities = 60/72 (83%), Positives = 67/72 (93%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDEIR SL+EHFGSCG++TRVSIPKDY+SGAVKGFAYVDF D DS KALELHE++LGGY Sbjct: 509 EDEIRGSLQEHFGSCGDITRVSIPKDYESGAVKGFAYVDFSDVDSMGKALELHETELGGY 568 Query: 70 TLSVDEAKPRDN 35 TL+VDEAKPRDN Sbjct: 569 TLTVDEAKPRDN 580 >XP_019413220.1 PREDICTED: nucleolin 2-like isoform X3 [Lupinus angustifolius] Length = 679 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 534 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 593 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 594 TLSVDEAKPRDS 605 >XP_019413219.1 PREDICTED: nucleolin 2-like isoform X2 [Lupinus angustifolius] Length = 679 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 534 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 593 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 594 TLSVDEAKPRDS 605 >XP_019413218.1 PREDICTED: nucleolin 2-like isoform X1 [Lupinus angustifolius] Length = 680 Score = 130 bits (328), Expect = 1e-33 Identities = 57/72 (79%), Positives = 69/72 (95%) Frame = -2 Query: 250 EDEIRASLEEHFGSCGEVTRVSIPKDYDSGAVKGFAYVDFKDSDSFNKALELHESDLGGY 71 EDE+R+SLEEHFG+CG+VTR+S+PKDYDSG +KGFAY+DFKD + F+KALELHES+LGGY Sbjct: 535 EDELRSSLEEHFGTCGQVTRISVPKDYDSGEIKGFAYLDFKDGEGFSKALELHESELGGY 594 Query: 70 TLSVDEAKPRDN 35 TLSVDEAKPRD+ Sbjct: 595 TLSVDEAKPRDS 606