BLASTX nr result
ID: Glycyrrhiza32_contig00013788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00013788 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU13045.1 hypothetical protein TSUD_173450 [Trifolium subterran... 46 2e-09 GAU38249.1 hypothetical protein TSUD_119290 [Trifolium subterran... 47 5e-08 GAU13047.1 hypothetical protein TSUD_173470 [Trifolium subterran... 47 1e-07 GAU38278.1 hypothetical protein TSUD_119590 [Trifolium subterran... 41 4e-07 XP_013448143.1 cyclin-like F-box protein [Medicago truncatula] K... 43 4e-07 XP_013448166.1 F-box/RNI superfamily protein, putative [Medicago... 43 4e-07 XP_013448146.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 43 4e-07 XP_013467007.1 cyclin-like F-box protein [Medicago truncatula] K... 44 5e-07 XP_013448167.1 cyclin-like F-box protein [Medicago truncatula] K... 44 5e-07 XP_013448653.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 46 5e-07 XP_003591969.2 F-box-like protein [Medicago truncatula] AES62220... 41 1e-06 XP_013450532.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 44 2e-06 XP_003629684.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 46 2e-06 GAU42368.1 hypothetical protein TSUD_350340 [Trifolium subterran... 54 3e-06 XP_003625380.1 cyclin-like F-box protein [Medicago truncatula] A... 47 3e-06 XP_012575618.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340... 45 3e-06 XP_003599617.1 cyclin-like F-box protein [Medicago truncatula] A... 43 4e-06 XP_013459471.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 41 5e-06 XP_003624289.1 F-box/RNI/FBD-like domain protein [Medicago trunc... 46 9e-06 ABN05919.1 Cyclin-like F-box; FBD [Medicago truncatula] 46 9e-06 >GAU13045.1 hypothetical protein TSUD_173450 [Trifolium subterraneum] Length = 343 Score = 46.2 bits (108), Expect(2) = 2e-09 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 K +V T++LSKRW PLWLS+LTLDFD Sbjct: 31 KQSVTTTILSKRWNPLWLSVLTLDFD 56 Score = 42.7 bits (99), Expect(2) = 2e-09 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = -3 Query: 150 SRRSCPMADRISAMPDSVLCHILS 79 SRRS P DRISA+PDSV+CHILS Sbjct: 3 SRRSIPTEDRISALPDSVICHILS 26 >GAU38249.1 hypothetical protein TSUD_119290 [Trifolium subterraneum] Length = 505 Score = 47.4 bits (111), Expect(2) = 5e-08 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 K A TS+LSKRWKPLWLS+ TLDFD Sbjct: 32 KFAATTSILSKRWKPLWLSVQTLDFD 57 Score = 37.0 bits (84), Expect(2) = 5e-08 Identities = 16/24 (66%), Positives = 18/24 (75%) Frame = -3 Query: 150 SRRSCPMADRISAMPDSVLCHILS 79 S RS P DRIS +PD +LCHILS Sbjct: 4 SGRSIPTTDRISELPDPILCHILS 27 >GAU13047.1 hypothetical protein TSUD_173470 [Trifolium subterraneum] Length = 387 Score = 46.6 bits (109), Expect(2) = 1e-07 Identities = 20/26 (76%), Positives = 22/26 (84%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 K A ATS+LSKRW PLWLS+L LDFD Sbjct: 27 KQAAATSILSKRWNPLWLSVLALDFD 52 Score = 36.2 bits (82), Expect(2) = 1e-07 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = -3 Query: 141 SCPMADRISAMPDSVLCHILSNSLSPQA 58 S P DRIS +PDS++CHILS + QA Sbjct: 2 SSPTVDRISTLPDSIICHILSFFPTKQA 29 >GAU38278.1 hypothetical protein TSUD_119590 [Trifolium subterraneum] Length = 534 Score = 41.2 bits (95), Expect(2) = 4e-07 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 147 RRSCPMADRISAMPDSVLCHILS 79 RRS P ADRIS +PDS+LCHILS Sbjct: 5 RRSIPTADRISDLPDSILCHILS 27 Score = 40.0 bits (92), Expect(2) = 4e-07 Identities = 16/24 (66%), Positives = 21/24 (87%) Frame = -2 Query: 73 AVATSVLSKRWKPLWLSLLTLDFD 2 A TS+LSKRWK +WLS+L+L+FD Sbjct: 34 AATTSILSKRWKSVWLSVLSLNFD 57 >XP_013448143.1 cyclin-like F-box protein [Medicago truncatula] KEH22170.1 cyclin-like F-box protein [Medicago truncatula] Length = 365 Score = 42.7 bits (99), Expect(2) = 4e-07 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 85 SLKLAVATSVLSKRWKPLWLSLLTLDFD 2 S K + ATS+LS+RW PLW S+ TLDFD Sbjct: 29 SAKQSAATSILSQRWNPLWHSVFTLDFD 56 Score = 38.5 bits (88), Expect(2) = 4e-07 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -3 Query: 150 SRRSCPMADRISAMPDSVLCHILS 79 S RS P DRIS +PDSV+CHILS Sbjct: 3 SHRSIPNVDRISNLPDSVICHILS 26 >XP_013448166.1 F-box/RNI superfamily protein, putative [Medicago truncatula] KEH22193.1 F-box/RNI superfamily protein, putative [Medicago truncatula] Length = 350 Score = 42.7 bits (99), Expect(2) = 4e-07 Identities = 18/24 (75%), Positives = 21/24 (87%) Frame = -2 Query: 73 AVATSVLSKRWKPLWLSLLTLDFD 2 + AT++LSKRWKPLW SLLTL FD Sbjct: 33 SAATTILSKRWKPLWHSLLTLHFD 56 Score = 38.5 bits (88), Expect(2) = 4e-07 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 150 SRRSCPMADRISAMPDSVLCHILS 79 S S P DRISA+PDS++CHILS Sbjct: 3 SHHSIPNVDRISALPDSIICHILS 26 >XP_013448146.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH22173.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 180 Score = 42.7 bits (99), Expect(2) = 4e-07 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 85 SLKLAVATSVLSKRWKPLWLSLLTLDFD 2 S K + ATS+LS+RW PLW S+ TLDFD Sbjct: 29 SAKQSAATSILSQRWNPLWHSVFTLDFD 56 Score = 38.5 bits (88), Expect(2) = 4e-07 Identities = 17/24 (70%), Positives = 19/24 (79%) Frame = -3 Query: 150 SRRSCPMADRISAMPDSVLCHILS 79 S RS P DRIS +PDSV+CHILS Sbjct: 3 SHRSIPNVDRISNLPDSVICHILS 26 >XP_013467007.1 cyclin-like F-box protein [Medicago truncatula] KEH41042.1 cyclin-like F-box protein [Medicago truncatula] Length = 386 Score = 43.9 bits (102), Expect(2) = 5e-07 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 K + ATS+LSKRW PLW S+LTLDFD Sbjct: 31 KQSAATSILSKRWYPLWHSVLTLDFD 56 Score = 37.0 bits (84), Expect(2) = 5e-07 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 150 SRRSCPMADRISAMPDSVLCHILS 79 S RS P DRISA+PD+++CH LS Sbjct: 3 SPRSIPTVDRISALPDNIICHTLS 26 >XP_013448167.1 cyclin-like F-box protein [Medicago truncatula] KEH22194.1 cyclin-like F-box protein [Medicago truncatula] Length = 381 Score = 44.3 bits (103), Expect(2) = 5e-07 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -2 Query: 85 SLKLAVATSVLSKRWKPLWLSLLTLDFD 2 S K + AT++LSKRWKPLWL LL L+FD Sbjct: 29 STKQSAATTILSKRWKPLWLLLLNLNFD 56 Score = 36.6 bits (83), Expect(2) = 5e-07 Identities = 15/24 (62%), Positives = 19/24 (79%) Frame = -3 Query: 150 SRRSCPMADRISAMPDSVLCHILS 79 S S P+ DRIS +PDS++CHILS Sbjct: 3 SPHSIPIVDRISVLPDSLICHILS 26 >XP_013448653.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH22680.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 293 Score = 45.8 bits (107), Expect(2) = 5e-07 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 K + ATS+LSKRWKP+WLS+ TLDFD Sbjct: 29 KNSAATSILSKRWKPIWLSVSTLDFD 54 Score = 35.0 bits (79), Expect(2) = 5e-07 Identities = 14/22 (63%), Positives = 18/22 (81%) Frame = -3 Query: 144 RSCPMADRISAMPDSVLCHILS 79 RS P DRIS++PD ++CHILS Sbjct: 3 RSNPTKDRISSLPDPIICHILS 24 >XP_003591969.2 F-box-like protein [Medicago truncatula] AES62220.2 F-box-like protein [Medicago truncatula] Length = 143 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 22/34 (64%), Positives = 25/34 (73%) Frame = -2 Query: 103 LSSVPHSLKLAVATSVLSKRWKPLWLSLLTLDFD 2 LS VP KLA TSVLSKRW+ +WLS+L L FD Sbjct: 60 LSFVP--TKLAAITSVLSKRWEQVWLSVLALYFD 91 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -3 Query: 147 RRSCPMADRISAMPDSVLCHILS 79 RR+ P DRIS +PDS+LCHILS Sbjct: 39 RRAIPTVDRISYLPDSILCHILS 61 >XP_013450532.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH24560.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 399 Score = 43.5 bits (101), Expect(2) = 2e-06 Identities = 18/26 (69%), Positives = 21/26 (80%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 KL+ ATS+LSKRW PLWLS+L FD Sbjct: 32 KLSAATSILSKRWNPLWLSVLNFHFD 57 Score = 35.4 bits (80), Expect(2) = 2e-06 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -3 Query: 147 RRSCPMADRISAMPDSVLCHILS 79 +RS P DRIS+ PD ++CHILS Sbjct: 5 QRSIPTEDRISSFPDHIICHILS 27 >XP_003629684.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] AET04160.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 331 Score = 45.8 bits (107), Expect(2) = 2e-06 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 K + TS+LSKRW PLWLS+LTLDFD Sbjct: 31 KQSATTSILSKRWNPLWLSVLTLDFD 56 Score = 33.1 bits (74), Expect(2) = 2e-06 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = -3 Query: 135 PMADRISAMPDSVLCHILS 79 P DRI +PDSV+CHILS Sbjct: 8 PTVDRIRVLPDSVICHILS 26 >GAU42368.1 hypothetical protein TSUD_350340 [Trifolium subterraneum] Length = 389 Score = 53.9 bits (128), Expect = 3e-06 Identities = 29/59 (49%), Positives = 40/59 (67%), Gaps = 10/59 (16%) Frame = -2 Query: 148 AAVMSNGRQDQCYAGLSSVPHSL----------KLAVATSVLSKRWKPLWLSLLTLDFD 2 + + S G++D+ +SS+P S+ K AVAT++LSKRWKPLWLS+LTLDFD Sbjct: 40 STIPSRGKEDR----VSSLPDSILCHILSFLPTKEAVATTILSKRWKPLWLSVLTLDFD 94 >XP_003625380.1 cyclin-like F-box protein [Medicago truncatula] AES81598.1 cyclin-like F-box protein [Medicago truncatula] Length = 391 Score = 46.6 bits (109), Expect(2) = 3e-06 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 KLA TSVLSKRWK LWLS+L+LDFD Sbjct: 38 KLAATTSVLSKRWKRLWLSVLSLDFD 63 Score = 31.6 bits (70), Expect(2) = 3e-06 Identities = 13/21 (61%), Positives = 15/21 (71%) Frame = -3 Query: 144 RSCPMADRISAMPDSVLCHIL 82 R DRIS +PDS+LCHIL Sbjct: 12 RKSSKVDRISDLPDSILCHIL 32 >XP_012575618.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340-like [Cicer arietinum] XP_012575619.1 PREDICTED: F-box/FBD/LRR-repeat protein At4g26340-like [Cicer arietinum] Length = 379 Score = 44.7 bits (104), Expect(2) = 3e-06 Identities = 19/26 (73%), Positives = 22/26 (84%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDFD 2 K A TS+LSKRWKPLWLS+L L+FD Sbjct: 23 KHAATTSILSKRWKPLWLSVLNLNFD 48 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 132 MADRISAMPDSVLCHILS 79 MAD IS +PDS+LCHILS Sbjct: 1 MADTISDLPDSILCHILS 18 >XP_003599617.1 cyclin-like F-box protein [Medicago truncatula] AES69868.1 cyclin-like F-box protein [Medicago truncatula] Length = 363 Score = 43.1 bits (100), Expect(2) = 4e-06 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -2 Query: 85 SLKLAVATSVLSKRWKPLWLSLLTLDFD 2 S K A TSVLSKRW+PLWLS+L L+F+ Sbjct: 23 STKQAAITSVLSKRWRPLWLSVLALNFN 50 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 16/24 (66%), Positives = 19/24 (79%) Frame = -3 Query: 129 ADRISAMPDSVLCHILSNSLSPQA 58 ADRIS +PDS+LCHILS + QA Sbjct: 4 ADRISNLPDSILCHILSFISTKQA 27 >XP_013459471.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] KEH33502.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 439 Score = 40.8 bits (94), Expect(2) = 5e-06 Identities = 18/28 (64%), Positives = 22/28 (78%) Frame = -2 Query: 85 SLKLAVATSVLSKRWKPLWLSLLTLDFD 2 S K A TSVLSKRW+PLW S+L L+F+ Sbjct: 61 STKQAAITSVLSKRWRPLWRSVLALNFN 88 Score = 36.6 bits (83), Expect(2) = 5e-06 Identities = 18/31 (58%), Positives = 22/31 (70%) Frame = -3 Query: 150 SRRSCPMADRISAMPDSVLCHILSNSLSPQA 58 SR S AD+IS +PDS+LCHILS + QA Sbjct: 35 SRLSIARADKISNLPDSILCHILSFISTKQA 65 >XP_003624289.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] AES80507.1 F-box/RNI/FBD-like domain protein [Medicago truncatula] Length = 256 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDF 5 K VATS+LSKRWKPLWLS+ TLDF Sbjct: 38 KDTVATSILSKRWKPLWLSVFTLDF 62 Score = 30.8 bits (68), Expect(2) = 9e-06 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 2/25 (8%) Frame = -3 Query: 147 RRSCPM--ADRISAMPDSVLCHILS 79 R S P+ DR S++PDS++CHILS Sbjct: 9 RSSIPIEECDRDSSLPDSIICHILS 33 >ABN05919.1 Cyclin-like F-box; FBD [Medicago truncatula] Length = 248 Score = 45.8 bits (107), Expect(2) = 9e-06 Identities = 20/25 (80%), Positives = 22/25 (88%) Frame = -2 Query: 79 KLAVATSVLSKRWKPLWLSLLTLDF 5 K VATS+LSKRWKPLWLS+ TLDF Sbjct: 38 KDTVATSILSKRWKPLWLSVFTLDF 62 Score = 30.8 bits (68), Expect(2) = 9e-06 Identities = 14/25 (56%), Positives = 19/25 (76%), Gaps = 2/25 (8%) Frame = -3 Query: 147 RRSCPM--ADRISAMPDSVLCHILS 79 R S P+ DR S++PDS++CHILS Sbjct: 9 RSSIPIEECDRDSSLPDSIICHILS 33