BLASTX nr result
ID: Glycyrrhiza32_contig00013675
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00013675 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU32850.1 hypothetical protein TSUD_209180 [Trifolium subterran... 57 1e-07 XP_003550760.1 PREDICTED: probable beta-1,3-galactosyltransferas... 50 8e-07 KHN48643.1 Putative beta-1,3-galactosyltransferase 19 [Glycine s... 45 4e-06 >GAU32850.1 hypothetical protein TSUD_209180 [Trifolium subterraneum] Length = 633 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = +3 Query: 3 CRVGKRVWEGIKWGKTKSNSSFVVKPENRSGSCPRSVSVTGS 128 CRVGKRVWE ++ KT + V+KPEN +G CPRSV VTGS Sbjct: 108 CRVGKRVWEELQLAKTPVQNGVVLKPENLTGLCPRSVWVTGS 149 >XP_003550760.1 PREDICTED: probable beta-1,3-galactosyltransferase 19 [Glycine max] KRH03397.1 hypothetical protein GLYMA_17G095300 [Glycine max] KRH03398.1 hypothetical protein GLYMA_17G095300 [Glycine max] Length = 602 Score = 50.1 bits (118), Expect(2) = 8e-07 Identities = 23/41 (56%), Positives = 29/41 (70%) Frame = +3 Query: 3 CRVGKRVWEGIKWGKTKSNSSFVVKPENRSGSCPRSVSVTG 125 CR GK +WE +K K++S + KPENRSG CP SVSV+G Sbjct: 80 CRAGKAIWEELKL-KSRSPRGLISKPENRSGPCPGSVSVSG 119 Score = 30.0 bits (66), Expect(2) = 8e-07 Identities = 14/20 (70%), Positives = 17/20 (85%) Frame = +2 Query: 128 ELMGREGRLVVIPCGLTLGS 187 E +GR G L++IPCGLTLGS Sbjct: 121 EFLGR-GSLMMIPCGLTLGS 139 >KHN48643.1 Putative beta-1,3-galactosyltransferase 19 [Glycine soja] Length = 603 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +3 Query: 3 CRVGKRVWEGIKWGKTKSNSSFVVKPENRSGSCPRSVSVTG 125 CR GK VWE ++ G S + PENRSG CP SVSV+G Sbjct: 83 CRAGKTVWEELRSG---SPPGPIPSPENRSGPCPESVSVSG 120 Score = 33.1 bits (74), Expect(2) = 4e-06 Identities = 17/33 (51%), Positives = 23/33 (69%) Frame = +2 Query: 128 ELMGREGRLVVIPCGLTLGSSQ*YFGIQLQRER 226 E +GR G ++VIPCGLTLGS + G L+ +R Sbjct: 122 EFLGR-GSVMVIPCGLTLGSHETVVGKPLRAQR 153