BLASTX nr result
ID: Glycyrrhiza32_contig00013657
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00013657 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004485687.1 PREDICTED: calcium-binding protein PBP1-like [Cic... 69 3e-13 XP_003593429.1 calcium-binding EF-hand protein [Medicago truncat... 68 6e-13 GAU36622.1 hypothetical protein TSUD_387740 [Trifolium subterran... 66 5e-12 KHN19089.1 Calcium-binding protein PBP1 [Glycine soja] KRH21601.... 65 6e-12 NP_001235458.1 uncharacterized protein LOC100306210 [Glycine max... 65 6e-12 KYP39914.1 Caltractin [Cajanus cajan] 64 2e-11 XP_017435929.1 PREDICTED: calcium-binding protein PBP1-like [Vig... 64 2e-11 XP_007148267.1 hypothetical protein PHAVU_006G194000g [Phaseolus... 64 2e-11 XP_015943255.1 PREDICTED: calcium-binding protein PBP1-like [Ara... 63 5e-11 XP_014518181.1 PREDICTED: calcium-binding protein PBP1-like [Vig... 64 6e-11 XP_003545803.1 PREDICTED: calcium-binding protein PBP1-like [Gly... 63 7e-11 XP_015887906.1 PREDICTED: calcium-binding protein PBP1-like [Ziz... 61 4e-10 XP_018854492.1 PREDICTED: calcium-binding protein PBP1-like [Jug... 61 4e-10 XP_018807709.1 PREDICTED: calcium-binding protein PBP1-like [Jug... 60 5e-10 XP_019425974.1 PREDICTED: calcium-binding protein PBP1-like [Lup... 59 3e-09 ONI10187.1 hypothetical protein PRUPE_4G033400 [Prunus persica] 58 4e-09 XP_008224908.1 PREDICTED: calcium-binding protein PBP1-like [Pru... 58 4e-09 XP_007213436.1 hypothetical protein PRUPE_ppa025547mg [Prunus pe... 58 4e-09 XP_016711147.1 PREDICTED: calcium-binding protein PBP1-like [Gos... 58 6e-09 XP_012454563.1 PREDICTED: calcium-binding protein PBP1-like [Gos... 58 6e-09 >XP_004485687.1 PREDICTED: calcium-binding protein PBP1-like [Cicer arietinum] Length = 118 Score = 68.9 bits (167), Expect = 3e-13 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIYTG 142 DGALNEMEFCTLMFRLSPALM+NSK+LLEEAI+TG Sbjct: 83 DGALNEMEFCTLMFRLSPALMNNSKQLLEEAIFTG 117 >XP_003593429.1 calcium-binding EF-hand protein [Medicago truncatula] AES63680.1 calcium-binding EF-hand protein [Medicago truncatula] Length = 118 Score = 68.2 bits (165), Expect = 6e-13 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIYTG 142 DGALNEMEFCTLMFRLSPALMS+SK+LLEEAI+TG Sbjct: 83 DGALNEMEFCTLMFRLSPALMSDSKQLLEEAIFTG 117 >GAU36622.1 hypothetical protein TSUD_387740 [Trifolium subterraneum] Length = 118 Score = 65.9 bits (159), Expect = 5e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIYTGL 139 DGAL+EMEFCTLMFRLSPALM++SK+LLEEAI+TG+ Sbjct: 83 DGALDEMEFCTLMFRLSPALMNDSKQLLEEAIFTGI 118 >KHN19089.1 Calcium-binding protein PBP1 [Glycine soja] KRH21601.1 hypothetical protein GLYMA_13G248200 [Glycine max] Length = 114 Score = 65.5 bits (158), Expect = 6e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIY 148 DGAL+EMEFCTLMFRLSPALM+NSKELLEEAIY Sbjct: 79 DGALDEMEFCTLMFRLSPALMNNSKELLEEAIY 111 >NP_001235458.1 uncharacterized protein LOC100306210 [Glycine max] ACU14281.1 unknown [Glycine max] Length = 114 Score = 65.5 bits (158), Expect = 6e-12 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIY 148 DGAL+EMEFCTLMFRLSPALM+NSKELLEEAIY Sbjct: 79 DGALDEMEFCTLMFRLSPALMNNSKELLEEAIY 111 >KYP39914.1 Caltractin [Cajanus cajan] Length = 114 Score = 63.9 bits (154), Expect = 2e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIY 148 DGAL+EMEFCTLMFRLSPALM+NSKELLEEAI+ Sbjct: 79 DGALDEMEFCTLMFRLSPALMNNSKELLEEAIF 111 >XP_017435929.1 PREDICTED: calcium-binding protein PBP1-like [Vigna angularis] KOM53866.1 hypothetical protein LR48_Vigan09g252500 [Vigna angularis] BAT86991.1 hypothetical protein VIGAN_05032600 [Vigna angularis var. angularis] Length = 114 Score = 63.9 bits (154), Expect = 2e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIY 148 DGAL+EMEFCTLMFRLSPALM+NSKELLEEAI+ Sbjct: 79 DGALDEMEFCTLMFRLSPALMNNSKELLEEAIF 111 >XP_007148267.1 hypothetical protein PHAVU_006G194000g [Phaseolus vulgaris] ESW20261.1 hypothetical protein PHAVU_006G194000g [Phaseolus vulgaris] Length = 114 Score = 63.9 bits (154), Expect = 2e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIY 148 DGAL+EMEFCTLMFRLSPALM+NSKELLEEAI+ Sbjct: 79 DGALDEMEFCTLMFRLSPALMNNSKELLEEAIF 111 >XP_015943255.1 PREDICTED: calcium-binding protein PBP1-like [Arachis duranensis] XP_016179613.1 PREDICTED: calcium-binding protein PBP1-like [Arachis ipaensis] Length = 114 Score = 63.2 bits (152), Expect = 5e-11 Identities = 29/34 (85%), Positives = 34/34 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIYT 145 DGAL+EMEFCTLMFRLSPALM+NSK+LLEEAI++ Sbjct: 79 DGALDEMEFCTLMFRLSPALMNNSKQLLEEAIFS 112 >XP_014518181.1 PREDICTED: calcium-binding protein PBP1-like [Vigna radiata var. radiata] Length = 154 Score = 63.9 bits (154), Expect = 6e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIY 148 DGAL+EMEFCTLMFRLSPALM+NSKELLEEAI+ Sbjct: 119 DGALDEMEFCTLMFRLSPALMNNSKELLEEAIF 151 >XP_003545803.1 PREDICTED: calcium-binding protein PBP1-like [Glycine max] KHN33632.1 Calcium-binding protein PBP1 [Glycine soja] KRH10720.1 hypothetical protein GLYMA_15G065700 [Glycine max] Length = 114 Score = 62.8 bits (151), Expect = 7e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIY 148 D AL+EMEFCTLMFRLSPALM+NSKELLEEAIY Sbjct: 79 DDALDEMEFCTLMFRLSPALMNNSKELLEEAIY 111 >XP_015887906.1 PREDICTED: calcium-binding protein PBP1-like [Ziziphus jujuba] Length = 113 Score = 60.8 bits (146), Expect = 4e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAI 151 DG LNEMEFCTLMFRLSPALM +SKELLEEAI Sbjct: 78 DGTLNEMEFCTLMFRLSPALMQSSKELLEEAI 109 >XP_018854492.1 PREDICTED: calcium-binding protein PBP1-like [Juglans regia] XP_018855132.1 PREDICTED: calcium-binding protein PBP1-like [Juglans regia] XP_018831380.1 PREDICTED: calcium-binding protein PBP1-like [Juglans regia] XP_018832302.1 PREDICTED: calcium-binding protein PBP1-like [Juglans regia] XP_018853653.1 PREDICTED: calcium-binding protein PBP1-like [Juglans regia] Length = 117 Score = 60.8 bits (146), Expect = 4e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAI 151 DGALNEMEFCTLMFRLSP LM +SKELLEEAI Sbjct: 82 DGALNEMEFCTLMFRLSPGLMESSKELLEEAI 113 >XP_018807709.1 PREDICTED: calcium-binding protein PBP1-like [Juglans regia] Length = 113 Score = 60.5 bits (145), Expect = 5e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAI 151 DGALNEMEFCTLMFRLSP LM +SKELLEEAI Sbjct: 78 DGALNEMEFCTLMFRLSPELMESSKELLEEAI 109 >XP_019425974.1 PREDICTED: calcium-binding protein PBP1-like [Lupinus angustifolius] OIV91623.1 hypothetical protein TanjilG_09035 [Lupinus angustifolius] Length = 116 Score = 58.5 bits (140), Expect = 3e-09 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIYTGL 139 DG L+EMEFCTLMFRLSP+ M+NSK+LLE+AI++ + Sbjct: 81 DGVLDEMEFCTLMFRLSPSFMNNSKQLLEDAIFSAI 116 >ONI10187.1 hypothetical protein PRUPE_4G033400 [Prunus persica] Length = 113 Score = 58.2 bits (139), Expect = 4e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAI 151 DG+LNEMEFCTLMFRLSPALM SK+L+EEA+ Sbjct: 78 DGSLNEMEFCTLMFRLSPALMQTSKDLMEEAL 109 >XP_008224908.1 PREDICTED: calcium-binding protein PBP1-like [Prunus mume] Length = 113 Score = 58.2 bits (139), Expect = 4e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAI 151 DG+LNEMEFCTLMFRLSPALM SK+L+EEA+ Sbjct: 78 DGSLNEMEFCTLMFRLSPALMQTSKDLMEEAL 109 >XP_007213436.1 hypothetical protein PRUPE_ppa025547mg [Prunus persica] Length = 113 Score = 58.2 bits (139), Expect = 4e-09 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAI 151 DG+LNEMEFCTLMFRLSPALM SK+L+EEA+ Sbjct: 78 DGSLNEMEFCTLMFRLSPALMQTSKDLMEEAL 109 >XP_016711147.1 PREDICTED: calcium-binding protein PBP1-like [Gossypium hirsutum] XP_017648605.1 PREDICTED: calcium-binding protein PBP1-like [Gossypium arboreum] Length = 111 Score = 57.8 bits (138), Expect = 6e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIYT 145 DG L+EMEFCTLMFRLSPALM +SK LLEEA+ T Sbjct: 76 DGGLDEMEFCTLMFRLSPALMKSSKSLLEEALVT 109 >XP_012454563.1 PREDICTED: calcium-binding protein PBP1-like [Gossypium raimondii] KJB69387.1 hypothetical protein B456_011G021000 [Gossypium raimondii] Length = 111 Score = 57.8 bits (138), Expect = 6e-09 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 246 DGALNEMEFCTLMFRLSPALMSNSKELLEEAIYT 145 DG L+EMEFCTLMFRLSPALM +SK LLEEA+ T Sbjct: 76 DGGLDEMEFCTLMFRLSPALMKSSKSLLEEALVT 109