BLASTX nr result
ID: Glycyrrhiza32_contig00013090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00013090 (598 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016176576.1 PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal pro... 73 6e-12 KYP74458.1 hypothetical protein KK1_007140 [Cajanus cajan] 71 2e-11 XP_015938901.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 71 2e-11 XP_008464054.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 69 2e-10 XP_008464053.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 69 2e-10 XP_004143147.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 67 5e-10 XP_004515342.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 67 6e-10 KHN00196.1 50S ribosomal protein L4, chloroplastic [Glycine soja] 64 8e-10 KGN47102.1 hypothetical protein Csa_6G187950 [Cucumis sativus] 67 9e-10 XP_018842943.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 67 1e-09 XP_007205651.1 hypothetical protein PRUPE_ppa009351mg [Prunus pe... 66 2e-09 XP_008220485.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 66 2e-09 XP_019450040.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 65 4e-09 XP_019450032.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 65 4e-09 XP_019450027.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 65 4e-09 XP_019450019.1 PREDICTED: 50S ribosomal protein L4, chloroplasti... 65 4e-09 GAV74468.1 Ribosomal_L4 domain-containing protein [Cephalotus fo... 65 5e-09 XP_007134448.1 hypothetical protein PHAVU_010G048100g [Phaseolus... 64 7e-09 XP_017182974.1 PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal pro... 64 9e-09 XP_010104677.1 50S ribosomal protein L4 [Morus notabilis] EXC014... 64 9e-09 >XP_016176576.1 PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L4, chloroplastic [Arachis ipaensis] Length = 296 Score = 72.8 bits (177), Expect = 6e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DILNADKLVLTPAAVDYLNQRYGV+YQ Sbjct: 224 LTPRTLNLFDILNADKLVLTPAAVDYLNQRYGVDYQ 259 >KYP74458.1 hypothetical protein KK1_007140 [Cajanus cajan] Length = 282 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNLYDILNADKLVLTP A+DYLNQRYGV+YQ Sbjct: 229 LTPRTLNLYDILNADKLVLTPEALDYLNQRYGVDYQ 264 >XP_015938901.1 PREDICTED: 50S ribosomal protein L4, chloroplastic [Arachis duranensis] Length = 296 Score = 71.2 bits (173), Expect = 2e-11 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DILNADKLVLTPAAVDYLN+RYGV+YQ Sbjct: 224 LTPRTLNLFDILNADKLVLTPAAVDYLNKRYGVDYQ 259 >XP_008464054.1 PREDICTED: 50S ribosomal protein L4, chloroplastic isoform X2 [Cucumis melo] Length = 291 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DIL++DKLVLTPAAVDYLN+RYG+NY+ Sbjct: 228 LTPRTLNLFDILDSDKLVLTPAAVDYLNERYGINYE 263 >XP_008464053.1 PREDICTED: 50S ribosomal protein L4, chloroplastic isoform X1 [Cucumis melo] Length = 297 Score = 68.9 bits (167), Expect = 2e-10 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DIL++DKLVLTPAAVDYLN+RYG+NY+ Sbjct: 228 LTPRTLNLFDILDSDKLVLTPAAVDYLNERYGINYE 263 >XP_004143147.1 PREDICTED: 50S ribosomal protein L4, chloroplastic [Cucumis sativus] Length = 288 Score = 67.4 bits (163), Expect = 5e-10 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DIL++DKLVLTP AVDYLN+RYG+NY+ Sbjct: 228 LTPRTLNLFDILDSDKLVLTPTAVDYLNERYGINYE 263 >XP_004515342.1 PREDICTED: 50S ribosomal protein L4, chloroplastic [Cicer arietinum] Length = 299 Score = 67.4 bits (163), Expect = 6e-10 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DILNADK+VLTPAAVDYLN RYG +YQ Sbjct: 234 LTPRTLNLFDILNADKIVLTPAAVDYLNNRYGDSYQ 269 >KHN00196.1 50S ribosomal protein L4, chloroplastic [Glycine soja] Length = 109 Score = 63.5 bits (153), Expect = 8e-10 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = +3 Query: 6 TPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 TPRTLNLYDIL+ADKLVLT AVDYLNQRYG +YQ Sbjct: 37 TPRTLNLYDILDADKLVLTQGAVDYLNQRYGGDYQ 71 >KGN47102.1 hypothetical protein Csa_6G187950 [Cucumis sativus] Length = 442 Score = 67.4 bits (163), Expect = 9e-10 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DIL++DKLVLTP AVDYLN+RYG+NY+ Sbjct: 382 LTPRTLNLFDILDSDKLVLTPTAVDYLNERYGINYE 417 >XP_018842943.1 PREDICTED: 50S ribosomal protein L4, chloroplastic [Juglans regia] Length = 294 Score = 66.6 bits (161), Expect = 1e-09 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVN 104 LTPRTLNLYDILN+DKLVLTPAAVDYLN RYGV+ Sbjct: 228 LTPRTLNLYDILNSDKLVLTPAAVDYLNSRYGVD 261 >XP_007205651.1 hypothetical protein PRUPE_ppa009351mg [Prunus persica] ONH99970.1 hypothetical protein PRUPE_6G060600 [Prunus persica] Length = 296 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DILNADKL+LTP VDYLN RYG+NY+ Sbjct: 225 LTPRTLNLFDILNADKLILTPEIVDYLNARYGLNYE 260 >XP_008220485.1 PREDICTED: 50S ribosomal protein L4, chloroplastic [Prunus mume] Length = 299 Score = 65.9 bits (159), Expect = 2e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DILNADKL+LTP VDYLN RYG+NY+ Sbjct: 225 LTPRTLNLFDILNADKLILTPEIVDYLNARYGLNYE 260 >XP_019450040.1 PREDICTED: 50S ribosomal protein L4, chloroplastic isoform X4 [Lupinus angustifolius] Length = 289 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNY 107 LTPRTLNLYDILNADKL+LT AVDYLN RYG++Y Sbjct: 226 LTPRTLNLYDILNADKLILTQGAVDYLNDRYGISY 260 >XP_019450032.1 PREDICTED: 50S ribosomal protein L4, chloroplastic isoform X3 [Lupinus angustifolius] Length = 295 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNY 107 LTPRTLNLYDILNADKL+LT AVDYLN RYG++Y Sbjct: 226 LTPRTLNLYDILNADKLILTQGAVDYLNDRYGISY 260 >XP_019450027.1 PREDICTED: 50S ribosomal protein L4, chloroplastic isoform X2 [Lupinus angustifolius] Length = 295 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNY 107 LTPRTLNLYDILNADKL+LT AVDYLN RYG++Y Sbjct: 226 LTPRTLNLYDILNADKLILTQGAVDYLNDRYGISY 260 >XP_019450019.1 PREDICTED: 50S ribosomal protein L4, chloroplastic isoform X1 [Lupinus angustifolius] OIW18822.1 hypothetical protein TanjilG_25265 [Lupinus angustifolius] Length = 298 Score = 65.1 bits (157), Expect = 4e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNY 107 LTPRTLNLYDILNADKL+LT AVDYLN RYG++Y Sbjct: 226 LTPRTLNLYDILNADKLILTQGAVDYLNDRYGISY 260 >GAV74468.1 Ribosomal_L4 domain-containing protein [Cephalotus follicularis] Length = 293 Score = 64.7 bits (156), Expect = 5e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DILN+DKLVLTPAAVDYLN RYGV+ + Sbjct: 230 LTPRTLNLFDILNSDKLVLTPAAVDYLNGRYGVDVE 265 >XP_007134448.1 hypothetical protein PHAVU_010G048100g [Phaseolus vulgaris] ESW06442.1 hypothetical protein PHAVU_010G048100g [Phaseolus vulgaris] Length = 308 Score = 64.3 bits (155), Expect = 7e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 6 TPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNY 107 TPRTLNLYDIL+ADKLVLT AVDYLNQRYGV+Y Sbjct: 236 TPRTLNLYDILDADKLVLTQGAVDYLNQRYGVDY 269 >XP_017182974.1 PREDICTED: LOW QUALITY PROTEIN: 50S ribosomal protein L4, chloroplastic-like [Malus domestica] Length = 285 Score = 63.9 bits (154), Expect = 9e-09 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNY 107 LTPRTLNL+DILNADKL++TP VDYLN RYGV+Y Sbjct: 225 LTPRTLNLFDILNADKLIMTPETVDYLNARYGVDY 259 >XP_010104677.1 50S ribosomal protein L4 [Morus notabilis] EXC01483.1 50S ribosomal protein L4 [Morus notabilis] Length = 293 Score = 63.9 bits (154), Expect = 9e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 3 LTPRTLNLYDILNADKLVLTPAAVDYLNQRYGVNYQ 110 LTPRTLNL+DILNADKLVLTP AV YLN+RYGV+++ Sbjct: 233 LTPRTLNLFDILNADKLVLTPGAVYYLNERYGVDFE 268