BLASTX nr result
ID: Glycyrrhiza32_contig00012847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00012847 (249 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAF11800.1 hypothetical protein DR_2252 [Deinococcus radiodurans... 59 3e-09 AAF09840.1 hypothetical protein DR_0254 [Deinococcus radiodurans... 59 4e-09 BAG46934.1 hypothetical protein BMULJ_05092 [Burkholderia multiv... 58 7e-09 >AAF11800.1 hypothetical protein DR_2252 [Deinococcus radiodurans R1] Length = 133 Score = 58.9 bits (141), Expect = 3e-09 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 2/83 (2%) Frame = -3 Query: 244 LVLSAEGLPTPLIVTRSGIRTCQRST--DRLRSASTQMATLSYYSP*SESATAARRLSPR 71 LVL+A+ + T IVT +GIRT ST + S T+ + + ES + LSP Sbjct: 29 LVLTAKKILTSFIVTHAGIRTSVGSTTPSGMASPRTERSPTRQLASRVESIASVDHLSPD 88 Query: 70 HFRRGMARPVSCYALLKWWLLLS 2 HFRR + RPVS YAL + WLLLS Sbjct: 89 HFRRIVTRPVSYYALFEGWLLLS 111 >AAF09840.1 hypothetical protein DR_0254 [Deinococcus radiodurans R1] Length = 139 Score = 58.9 bits (141), Expect = 4e-09 Identities = 37/83 (44%), Positives = 48/83 (57%), Gaps = 2/83 (2%) Frame = -3 Query: 244 LVLSAEGLPTPLIVTRSGIRTCQRST--DRLRSASTQMATLSYYSP*SESATAARRLSPR 71 LVL+A+ + T IVT +GIRT ST + S T+ + + ES + LSP Sbjct: 35 LVLTAKKILTSFIVTHAGIRTSVGSTTPSGMASPRTERSPTRQLASRVESIASVDHLSPD 94 Query: 70 HFRRGMARPVSCYALLKWWLLLS 2 HFRR + RPVS YAL + WLLLS Sbjct: 95 HFRRIVTRPVSYYALFEGWLLLS 117 >BAG46934.1 hypothetical protein BMULJ_05092 [Burkholderia multivorans ATCC 17616] Length = 123 Score = 57.8 bits (138), Expect = 7e-09 Identities = 35/82 (42%), Positives = 43/82 (52%) Frame = -3 Query: 247 NLVLSAEGLPTPLIVTRSGIRTCQRSTDRLRSASTQMATLSYYSP*SESATAARRLSPRH 68 NL L+A G TP I T IRT S+ ++ S TLSY++ SA + L+P H Sbjct: 28 NLGLTARGPFTPFIATHVSIRTSDTSSTLYKAPSQAYGTLSYHACKHASAASVYGLAPLH 87 Query: 67 FRRGMARPVSCYALLKWWLLLS 2 R R VS YA K WLLLS Sbjct: 88 LPRRTTRSVSYYAFFKGWLLLS 109