BLASTX nr result
ID: Glycyrrhiza32_contig00012297
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00012297 (222 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU22144.1 hypothetical protein TSUD_251720 [Trifolium subterran... 69 1e-12 KYP73246.1 Calcium-dependent protein kinase 17 [Cajanus cajan] 70 2e-12 XP_004491231.1 PREDICTED: calcium-dependent protein kinase 17-li... 69 5e-12 XP_007141507.1 hypothetical protein PHAVU_008G201900g [Phaseolus... 69 5e-12 XP_003617233.1 calmodulin-domain kinase CDPK protein [Medicago t... 69 5e-12 XP_019457091.1 PREDICTED: calcium-dependent protein kinase 17-li... 68 1e-11 XP_019460436.1 PREDICTED: calcium-dependent protein kinase 17-li... 68 1e-11 XP_019457090.1 PREDICTED: calcium-dependent protein kinase 17-li... 68 1e-11 OIW04179.1 hypothetical protein TanjilG_00739 [Lupinus angustifo... 68 1e-11 XP_019457092.1 PREDICTED: calcium-dependent protein kinase 17-li... 67 2e-11 XP_003617244.2 calcium-dependent kinase [Medicago truncatula] AE... 65 2e-11 XP_017430615.1 PREDICTED: calcium-dependent protein kinase 17-li... 67 3e-11 XP_019434654.1 PREDICTED: calcium-dependent protein kinase 17-li... 66 7e-11 OIW16471.1 hypothetical protein TanjilG_18998, partial [Lupinus ... 65 1e-10 XP_017430616.1 PREDICTED: calcium-dependent protein kinase 34-li... 65 2e-10 GAV62130.1 Pkinase domain-containing protein/EF_hand_5 domain-co... 65 2e-10 KOM46654.1 hypothetical protein LR48_Vigan07g035800 [Vigna angul... 65 2e-10 OIW18046.1 hypothetical protein TanjilG_07537 [Lupinus angustifo... 62 2e-10 XP_007146136.1 hypothetical protein PHAVU_006G015300g [Phaseolus... 64 2e-10 CBI24256.3 unnamed protein product, partial [Vitis vinifera] 64 3e-10 >GAU22144.1 hypothetical protein TSUD_251720 [Trifolium subterraneum] Length = 217 Score = 68.9 bits (167), Expect = 1e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE+NMHDGRDIKEI+SEVDADN R Sbjct: 155 YITIEELEQALHEYNMHDGRDIKEIISEVDADNDGR 190 >KYP73246.1 Calcium-dependent protein kinase 17 [Cajanus cajan] Length = 522 Score = 70.1 bits (170), Expect = 2e-12 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHEFNMHDGRDIKEI+SEVDADN R Sbjct: 459 YITIEELEQALHEFNMHDGRDIKEIISEVDADNDGR 494 >XP_004491231.1 PREDICTED: calcium-dependent protein kinase 17-like [Cicer arietinum] Length = 520 Score = 68.9 bits (167), Expect = 5e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE+NMHDGRDIKEI+SEVDADN R Sbjct: 457 YITIEELEQALHEYNMHDGRDIKEIISEVDADNDGR 492 >XP_007141507.1 hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris] ESW13501.1 hypothetical protein PHAVU_008G201900g [Phaseolus vulgaris] Length = 521 Score = 68.9 bits (167), Expect = 5e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHEFNMHDGRDIK+I+SEVDADN R Sbjct: 458 YITIEELEQALHEFNMHDGRDIKDIISEVDADNDGR 493 >XP_003617233.1 calmodulin-domain kinase CDPK protein [Medicago truncatula] AET00192.1 calmodulin-domain kinase CDPK protein [Medicago truncatula] Length = 523 Score = 68.9 bits (167), Expect = 5e-12 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE+NMHDGRDIKEI+SEVDADN R Sbjct: 460 YITIEELEQALHEYNMHDGRDIKEIISEVDADNDGR 495 >XP_019457091.1 PREDICTED: calcium-dependent protein kinase 17-like isoform X2 [Lupinus angustifolius] Length = 525 Score = 67.8 bits (164), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE+NMHDGRDIKEI++EVDADN R Sbjct: 461 YITIEELEQALHEYNMHDGRDIKEIIAEVDADNDGR 496 >XP_019460436.1 PREDICTED: calcium-dependent protein kinase 17-like [Lupinus angustifolius] OIW02809.1 hypothetical protein TanjilG_29585 [Lupinus angustifolius] Length = 531 Score = 67.8 bits (164), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE+NMHDGRDIKEI++EVDADN R Sbjct: 467 YITIEELEQALHEYNMHDGRDIKEIIAEVDADNDGR 502 >XP_019457090.1 PREDICTED: calcium-dependent protein kinase 17-like isoform X1 [Lupinus angustifolius] Length = 535 Score = 67.8 bits (164), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE+NMHDGRDIKEI++EVDADN R Sbjct: 471 YITIEELEQALHEYNMHDGRDIKEIIAEVDADNDGR 506 >OIW04179.1 hypothetical protein TanjilG_00739 [Lupinus angustifolius] Length = 580 Score = 67.8 bits (164), Expect = 1e-11 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE+NMHDGRDIKEI++EVDADN R Sbjct: 471 YITIEELEQALHEYNMHDGRDIKEIIAEVDADNDGR 506 >XP_019457092.1 PREDICTED: calcium-dependent protein kinase 17-like isoform X3 [Lupinus angustifolius] OIW04180.1 hypothetical protein TanjilG_00740 [Lupinus angustifolius] Length = 525 Score = 67.4 bits (163), Expect = 2e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YIT+EELEQALHE+NMHDGRDIKEI++EVDADN R Sbjct: 461 YITVEELEQALHEYNMHDGRDIKEIIAEVDADNDGR 496 >XP_003617244.2 calcium-dependent kinase [Medicago truncatula] AET00203.2 calcium-dependent kinase [Medicago truncatula] Length = 194 Score = 65.5 bits (158), Expect = 2e-11 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE+NMHDGR IKEI+SEVDADN R Sbjct: 131 YITIEELEQALHEYNMHDGRYIKEIISEVDADNDGR 166 >XP_017430615.1 PREDICTED: calcium-dependent protein kinase 17-like isoform X1 [Vigna angularis] Length = 522 Score = 67.0 bits (162), Expect = 3e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVS 200 YITIEELEQAL EFNMHDGRDIK+I+SEVDADNVS Sbjct: 457 YITIEELEQALIEFNMHDGRDIKDIISEVDADNVS 491 >XP_019434654.1 PREDICTED: calcium-dependent protein kinase 17-like [Lupinus angustifolius] Length = 532 Score = 65.9 bits (159), Expect = 7e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQALHE++MHDGRDIKEI++EVDADN R Sbjct: 468 YITIEELEQALHEYDMHDGRDIKEIIAEVDADNDGR 503 >OIW16471.1 hypothetical protein TanjilG_18998, partial [Lupinus angustifolius] Length = 565 Score = 65.1 bits (157), Expect = 1e-10 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADN 194 YITIEELEQALHE++MHDGRDIKEI++EVDADN Sbjct: 468 YITIEELEQALHEYDMHDGRDIKEIIAEVDADN 500 >XP_017430616.1 PREDICTED: calcium-dependent protein kinase 34-like isoform X2 [Vigna angularis] BAT80869.1 hypothetical protein VIGAN_03048600 [Vigna angularis var. angularis] Length = 520 Score = 64.7 bits (156), Expect = 2e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQAL EFNMHDGRDIK+I+SEVDADN R Sbjct: 457 YITIEELEQALIEFNMHDGRDIKDIISEVDADNDGR 492 >GAV62130.1 Pkinase domain-containing protein/EF_hand_5 domain-containing protein [Cephalotus follicularis] Length = 538 Score = 64.7 bits (156), Expect = 2e-10 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YIT EELEQALHE+ MHDGRDIKEI+SEVDADN R Sbjct: 476 YITTEELEQALHEYGMHDGRDIKEIISEVDADNDGR 511 >KOM46654.1 hypothetical protein LR48_Vigan07g035800 [Vigna angularis] Length = 539 Score = 64.7 bits (156), Expect = 2e-10 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YITIEELEQAL EFNMHDGRDIK+I+SEVDADN R Sbjct: 457 YITIEELEQALIEFNMHDGRDIKDIISEVDADNDGR 492 >OIW18046.1 hypothetical protein TanjilG_07537 [Lupinus angustifolius] Length = 153 Score = 62.0 bits (149), Expect = 2e-10 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 +IT EELEQALH++NMHDGRDIKEIL EVD DN R Sbjct: 89 FITTEELEQALHDYNMHDGRDIKEILQEVDGDNDGR 124 >XP_007146136.1 hypothetical protein PHAVU_006G015300g [Phaseolus vulgaris] ESW18130.1 hypothetical protein PHAVU_006G015300g [Phaseolus vulgaris] Length = 544 Score = 64.3 bits (155), Expect = 2e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 +IT EELEQALHEFNMHDGRDIKEIL EVD DN R Sbjct: 480 FITTEELEQALHEFNMHDGRDIKEILQEVDGDNDGR 515 >CBI24256.3 unnamed protein product, partial [Vitis vinifera] Length = 497 Score = 63.9 bits (154), Expect = 3e-10 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = +3 Query: 96 YITIEELEQALHEFNMHDGRDIKEILSEVDADNVSR 203 YIT EELEQALHEF MHDGRDIKEIL+EVD DN R Sbjct: 435 YITTEELEQALHEFGMHDGRDIKEILNEVDGDNDGR 470