BLASTX nr result
ID: Glycyrrhiza32_contig00011661
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00011661 (328 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU24798.1 hypothetical protein TSUD_157110 [Trifolium subterran... 114 8e-29 XP_004509034.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 2e-25 XP_004509035.1 PREDICTED: pentatricopeptide repeat-containing pr... 103 1e-23 XP_013457537.1 PPR containing plant-like protein [Medicago trunc... 94 5e-20 XP_016186831.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 3e-17 XP_015960066.1 PREDICTED: pentatricopeptide repeat-containing pr... 86 3e-17 XP_015896747.1 PREDICTED: putative pentatricopeptide repeat-cont... 84 2e-16 XP_014506512.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_016570883.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 1e-15 XP_003525595.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 3e-15 XP_019446007.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 7e-15 XP_017414346.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 2e-14 XP_007155743.1 hypothetical protein PHAVU_003G227900g [Phaseolus... 75 1e-13 GAV62336.1 PPR domain-containing protein/PPR_2 domain-containing... 75 1e-13 JAU32587.1 Putative pentatricopeptide repeat-containing protein,... 70 2e-13 XP_016455915.1 PREDICTED: putative pentatricopeptide repeat-cont... 74 3e-13 XP_009596666.1 PREDICTED: putative pentatricopeptide repeat-cont... 74 3e-13 XP_019252537.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 5e-13 XP_016505872.1 PREDICTED: putative pentatricopeptide repeat-cont... 74 5e-13 XP_009804318.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 5e-13 >GAU24798.1 hypothetical protein TSUD_157110 [Trifolium subterraneum] Length = 288 Score = 114 bits (285), Expect = 8e-29 Identities = 59/85 (69%), Positives = 66/85 (77%) Frame = +2 Query: 71 KHAWTCSSTGTGWVRKRSEEQVLLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIK 250 KHAWTCS+T W++ SEEQ LL LESCDGI+QFNQVH QL++ GLFQH LVA RAIK Sbjct: 6 KHAWTCSNTR--WMK--SEEQ-LLSTLESCDGIKQFNQVHTQLIIHGLFQHSLVASRAIK 60 Query: 251 KLCSHSRAAQRAVSLFDHLHTPDAF 325 KLCSH R RA LFD+LH PDAF Sbjct: 61 KLCSHPRTTPRATLLFDNLHHPDAF 85 >XP_004509034.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cicer arietinum] Length = 227 Score = 103 bits (258), Expect = 2e-25 Identities = 56/85 (65%), Positives = 62/85 (72%) Frame = +2 Query: 71 KHAWTCSSTGTGWVRKRSEEQVLLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIK 250 KHAWTCSS W +SEEQ LL AL+SCDGI+QFNQVH QL++ LFQHP VA AIK Sbjct: 6 KHAWTCSSRQ--W--SKSEEQ-LLSALQSCDGIKQFNQVHTQLILHNLFQHPFVATTAIK 60 Query: 251 KLCSHSRAAQRAVSLFDHLHTPDAF 325 KL S+ R RA SLFD LH PDAF Sbjct: 61 KLSSNPRTTPRATSLFDQLHHPDAF 85 >XP_004509035.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Cicer arietinum] Length = 574 Score = 103 bits (258), Expect = 1e-23 Identities = 56/85 (65%), Positives = 62/85 (72%) Frame = +2 Query: 71 KHAWTCSSTGTGWVRKRSEEQVLLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIK 250 KHAWTCSS W +SEEQ LL AL+SCDGI+QFNQVH QL++ LFQHP VA AIK Sbjct: 6 KHAWTCSSRQ--W--SKSEEQ-LLSALQSCDGIKQFNQVHTQLILHNLFQHPFVATTAIK 60 Query: 251 KLCSHSRAAQRAVSLFDHLHTPDAF 325 KL S+ R RA SLFD LH PDAF Sbjct: 61 KLSSNPRTTPRATSLFDQLHHPDAF 85 >XP_013457537.1 PPR containing plant-like protein [Medicago truncatula] KEH31568.1 PPR containing plant-like protein [Medicago truncatula] Length = 575 Score = 93.6 bits (231), Expect = 5e-20 Identities = 45/85 (52%), Positives = 56/85 (65%) Frame = +2 Query: 71 KHAWTCSSTGTGWVRKRSEEQVLLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIK 250 KHAWTC++T R+R+ + LL ALES G Q FNQ+H QL++ L QHPL++ AIK Sbjct: 6 KHAWTCNTT-----RRRNSPEQLLSALESTTGTQHFNQIHTQLIINNLIQHPLLSTTAIK 60 Query: 251 KLCSHSRAAQRAVSLFDHLHTPDAF 325 KL SH R + FDHLH PDAF Sbjct: 61 KLSSHPRTTPSSALFFDHLHHPDAF 85 >XP_016186831.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Arachis ipaensis] XP_016186838.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Arachis ipaensis] Length = 619 Score = 85.5 bits (210), Expect = 3e-17 Identities = 40/63 (63%), Positives = 48/63 (76%) Frame = +2 Query: 137 LLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHTP 316 +L L+SC GI+QFNQVH QL+V G+FQ+PL AGRAIKKLCS A RA LFD++ P Sbjct: 39 ILFLLDSCAGIRQFNQVHTQLLVSGIFQNPLAAGRAIKKLCSDPLTAPRATHLFDYVRQP 98 Query: 317 DAF 325 DAF Sbjct: 99 DAF 101 >XP_015960066.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Arachis duranensis] Length = 619 Score = 85.5 bits (210), Expect = 3e-17 Identities = 40/63 (63%), Positives = 48/63 (76%) Frame = +2 Query: 137 LLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHTP 316 +L L+SC GI+QFNQVH QL+V G+FQ+PL AGRAIKKLCS A RA LFD++ P Sbjct: 39 ILFLLDSCAGIRQFNQVHTQLLVSGIFQNPLAAGRAIKKLCSDPLTAPRATHLFDYVRQP 98 Query: 317 DAF 325 DAF Sbjct: 99 DAF 101 >XP_015896747.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Ziziphus jujuba] Length = 645 Score = 83.6 bits (205), Expect = 2e-16 Identities = 41/63 (65%), Positives = 45/63 (71%) Frame = +2 Query: 137 LLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHTP 316 +L L+SC G + FNQVH QL+V GLFQH A RAIKKLCS S AQ AV LFDHL P Sbjct: 62 ILRTLDSCIGTRHFNQVHTQLIVSGLFQHSFAASRAIKKLCSASDTAQHAVYLFDHLEEP 121 Query: 317 DAF 325 DAF Sbjct: 122 DAF 124 >XP_014506512.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vigna radiata var. radiata] Length = 576 Score = 80.9 bits (198), Expect = 1e-15 Identities = 41/67 (61%), Positives = 47/67 (70%) Frame = +2 Query: 125 EEQVLLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDH 304 +EQVL ALES +Q+ +Q+ QL+V GL QHPL A AIKKLCSHS RA S FDH Sbjct: 7 QEQVLFAALESWKEVQELSQLLVQLVVSGLSQHPLFATLAIKKLCSHSLTLPRATSFFDH 66 Query: 305 LHTPDAF 325 LH PDAF Sbjct: 67 LHHPDAF 73 >XP_016570883.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Capsicum annuum] Length = 642 Score = 80.9 bits (198), Expect = 1e-15 Identities = 42/90 (46%), Positives = 54/90 (60%), Gaps = 1/90 (1%) Frame = +2 Query: 59 NRATKHAWTCSSTGTGWVRKRSEEQVLLLALESCDG-IQQFNQVHAQLMVRGLFQHPLVA 235 NR H + S G V + +L L+SC ++QFNQVH QL+VRG+FQHPL A Sbjct: 40 NRDHDHVESFDSYSNGVVHILTSGHPILRMLDSCTAKLRQFNQVHGQLVVRGIFQHPLAA 99 Query: 236 GRAIKKLCSHSRAAQRAVSLFDHLHTPDAF 325 GR + KLCS AV +F++L TPDAF Sbjct: 100 GRVMMKLCSSRSTLHHAVKIFENLETPDAF 129 >XP_003525595.1 PREDICTED: pentatricopeptide repeat-containing protein At1g08070, chloroplastic-like [Glycine max] KRH57564.1 hypothetical protein GLYMA_05G069000 [Glycine max] Length = 595 Score = 80.1 bits (196), Expect = 3e-15 Identities = 41/69 (59%), Positives = 47/69 (68%) Frame = +2 Query: 119 RSEEQVLLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLF 298 R + +VL ALES + + NQV +QL+V GL QHPL A AIKKLCSHS RA LF Sbjct: 4 RGKHEVLFAALESWKNLHELNQVLSQLIVSGLSQHPLFATSAIKKLCSHSVTFPRATFLF 63 Query: 299 DHLHTPDAF 325 DHLH PDAF Sbjct: 64 DHLHHPDAF 72 >XP_019446007.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Lupinus angustifolius] OIW10318.1 hypothetical protein TanjilG_28069 [Lupinus angustifolius] Length = 620 Score = 79.0 bits (193), Expect = 7e-15 Identities = 36/63 (57%), Positives = 45/63 (71%) Frame = +2 Query: 137 LLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHTP 316 +L AL+S +G+ FNQ+HAQL V G+FQH L AGR IKKLCS RA+ +FDH+ P Sbjct: 33 ILRALDSSNGLHHFNQIHAQLTVSGIFQHSLAAGRFIKKLCSKPHTLARAILIFDHVRYP 92 Query: 317 DAF 325 DAF Sbjct: 93 DAF 95 >XP_017414346.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Vigna angularis] KOM32493.1 hypothetical protein LR48_Vigan01g204900 [Vigna angularis] BAT75764.1 hypothetical protein VIGAN_01368000 [Vigna angularis var. angularis] Length = 596 Score = 77.8 bits (190), Expect = 2e-14 Identities = 40/67 (59%), Positives = 46/67 (68%) Frame = +2 Query: 125 EEQVLLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDH 304 +EQVL ALES +Q+ Q+ QL+V GL QHPL A AIKKLCS+S RA S FDH Sbjct: 7 QEQVLFAALESWKEVQELTQLLVQLVVSGLSQHPLFATLAIKKLCSNSLTLPRATSFFDH 66 Query: 305 LHTPDAF 325 LH PDAF Sbjct: 67 LHHPDAF 73 >XP_007155743.1 hypothetical protein PHAVU_003G227900g [Phaseolus vulgaris] ESW27737.1 hypothetical protein PHAVU_003G227900g [Phaseolus vulgaris] Length = 597 Score = 75.5 bits (184), Expect = 1e-13 Identities = 40/66 (60%), Positives = 44/66 (66%) Frame = +2 Query: 128 EQVLLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHL 307 EQVL ALES +Q+ Q+ QL+V GL QHPL A AIKKL SHS RA S FDHL Sbjct: 8 EQVLFAALESRKELQELRQLLVQLVVSGLSQHPLFATSAIKKLSSHSLTLPRATSFFDHL 67 Query: 308 HTPDAF 325 H PDAF Sbjct: 68 HHPDAF 73 >GAV62336.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 635 Score = 75.5 bits (184), Expect = 1e-13 Identities = 35/63 (55%), Positives = 43/63 (68%) Frame = +2 Query: 137 LLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHTP 316 +L LESC I FNQ+HAQL+V GLFQHPL AGR +KKLC+ + A +FD + P Sbjct: 63 ILHTLESCSNITDFNQIHAQLIVSGLFQHPLAAGRVVKKLCTCLNSVFLAAFVFDSIEQP 122 Query: 317 DAF 325 DAF Sbjct: 123 DAF 125 >JAU32587.1 Putative pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 83 Score = 69.7 bits (169), Expect = 2e-13 Identities = 33/63 (52%), Positives = 45/63 (71%) Frame = +2 Query: 137 LLLALESCDGIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHTP 316 +L LES + +F+QV+AQ++V GL QH LV+GR IKKLC+ + RAVS+FD + P Sbjct: 1 MLQKLESLRSVNEFDQVYAQIVVSGLLQHSLVSGRVIKKLCTCFHSVSRAVSVFDSIDEP 60 Query: 317 DAF 325 DAF Sbjct: 61 DAF 63 >XP_016455915.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Nicotiana tabacum] Length = 639 Score = 74.3 bits (181), Expect = 3e-13 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +2 Query: 137 LLLALESCDG-IQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHT 313 +L L+ C ++ FNQ+HAQL+V G+FQHPL AGRA+KKLCS AV +F++L T Sbjct: 63 ILRILDFCTPKLRHFNQIHAQLIVSGIFQHPLAAGRAVKKLCSSQLTFAHAVKIFENLET 122 Query: 314 PDAF 325 PDAF Sbjct: 123 PDAF 126 >XP_009596666.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Nicotiana tomentosiformis] Length = 639 Score = 74.3 bits (181), Expect = 3e-13 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +2 Query: 137 LLLALESCDG-IQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHT 313 +L L+ C ++ FNQ+HAQL+V G+FQHPL AGRA+KKLCS AV +F++L T Sbjct: 63 ILRILDFCTPKLRHFNQIHAQLIVSGIFQHPLAAGRAVKKLCSSQLTFAHAVKIFENLET 122 Query: 314 PDAF 325 PDAF Sbjct: 123 PDAF 126 >XP_019252537.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Nicotiana attenuata] OIS99788.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 639 Score = 73.6 bits (179), Expect = 5e-13 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +2 Query: 137 LLLALESCDG-IQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHT 313 +L L+SC ++ FNQ+H+QL++ G+FQHPL AGR +KKLCS AV +F++L T Sbjct: 63 ILRILDSCTANLRHFNQIHSQLILSGIFQHPLAAGRVVKKLCSSQLTFAHAVKIFENLET 122 Query: 314 PDAF 325 PDAF Sbjct: 123 PDAF 126 >XP_016505872.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g37570 [Nicotiana tabacum] Length = 639 Score = 73.6 bits (179), Expect = 5e-13 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +2 Query: 137 LLLALESCD-GIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHT 313 +L L+SC ++ FNQ+H+QL++ G+FQHPL AGR +KKLCS AV +F++L T Sbjct: 63 ILRILDSCTPNLKYFNQIHSQLILSGIFQHPLAAGRVVKKLCSSQLTLTHAVKIFENLET 122 Query: 314 PDAF 325 PDAF Sbjct: 123 PDAF 126 >XP_009804318.1 PREDICTED: pentatricopeptide repeat-containing protein At3g29230-like [Nicotiana sylvestris] Length = 639 Score = 73.6 bits (179), Expect = 5e-13 Identities = 33/64 (51%), Positives = 46/64 (71%), Gaps = 1/64 (1%) Frame = +2 Query: 137 LLLALESCD-GIQQFNQVHAQLMVRGLFQHPLVAGRAIKKLCSHSRAAQRAVSLFDHLHT 313 +L L+SC ++ FNQ+H+QL++ G+FQHPL AGR +KKLCS AV +F++L T Sbjct: 63 ILRILDSCTPNLKYFNQIHSQLILSGIFQHPLAAGRVVKKLCSSQLTLTHAVKIFENLET 122 Query: 314 PDAF 325 PDAF Sbjct: 123 PDAF 126