BLASTX nr result
ID: Glycyrrhiza32_contig00009817
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00009817 (278 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAQ49644.1 stringent starvation protein B (plasmid) [Methylobact... 47 1e-06 >BAQ49644.1 stringent starvation protein B (plasmid) [Methylobacterium aquaticum] Length = 594 Score = 47.4 bits (111), Expect(2) = 1e-06 Identities = 29/56 (51%), Positives = 35/56 (62%), Gaps = 6/56 (10%) Frame = -3 Query: 276 RIDEGVKIVLLPGMVPPSSG*TSSCKRQLC----GSTSRCLMQCDSFKSSP--RGS 127 RIDEGVK+ L GMVPP SG +SC+RQLC G S Q S++ +P RGS Sbjct: 296 RIDEGVKVELSLGMVPPLSGQCNSCQRQLCSGGGGRVSGPQYQTKSYRVAPNRRGS 351 Score = 32.0 bits (71), Expect(2) = 1e-06 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -1 Query: 131 VRTSRRGSEVPGNRNLHF 78 V +RRGSE PGNR+LHF Sbjct: 344 VAPNRRGSEAPGNRSLHF 361