BLASTX nr result
ID: Glycyrrhiza32_contig00009763
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00009763 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_007516923.1 hypothetical protein GlmaxMp74 (mitochondrion) [G... 69 5e-13 >YP_007516923.1 hypothetical protein GlmaxMp74 (mitochondrion) [Glycine max] AFR34375.1 hypothetical protein GlmaxMp74 (mitochondrion) [Glycine max] Length = 100 Score = 69.3 bits (168), Expect = 5e-13 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = +1 Query: 232 SGCEIPNSNERDDQIYMLTKCFACNRWQKD 321 SGCEIPN NERDDQIYMLTKCFACNRWQKD Sbjct: 71 SGCEIPNLNERDDQIYMLTKCFACNRWQKD 100