BLASTX nr result
ID: Glycyrrhiza32_contig00009324
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00009324 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003629566.2 disease resistance protein (CC-NBS-LRR class) fam... 62 2e-09 KYP47980.1 putative disease resistance protein At5g66890 family ... 57 1e-08 XP_003629563.1 disease resistance protein (CC-NBS-LRR class) fam... 58 7e-08 GAU49137.1 hypothetical protein TSUD_191390 [Trifolium subterran... 57 1e-07 >XP_003629566.2 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] AET04042.2 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] Length = 791 Score = 62.4 bits (150), Expect = 2e-09 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +3 Query: 3 TLPGSVTKLERLLHLICDEETAEFWTRYFKPSLPKVEIEEAKNDKLFIIV 152 TLPGSVTKL+ L HLICD+ETA W FKPSLP ++IEEA+ + LFIIV Sbjct: 744 TLPGSVTKLKNLKHLICDQETAVCWEN-FKPSLPNLKIEEAEVN-LFIIV 791 >KYP47980.1 putative disease resistance protein At5g66890 family [Cajanus cajan] Length = 128 Score = 57.4 bits (137), Expect = 1e-08 Identities = 27/47 (57%), Positives = 32/47 (68%) Frame = +3 Query: 6 LPGSVTKLERLLHLICDEETAEFWTRYFKPSLPKVEIEEAKNDKLFI 146 +P V KLE L ++ CDEETAE W FKPSLP + IEEA + LFI Sbjct: 77 MPSLVMKLENLKYVRCDEETAEIWKADFKPSLPNLNIEEANDHNLFI 123 >XP_003629563.1 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] AET04039.1 disease resistance protein (CC-NBS-LRR class) family protein [Medicago truncatula] Length = 798 Score = 57.8 bits (138), Expect = 7e-08 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +3 Query: 3 TLPGSVTKLERLLHLICDEETAEFWTRYFKPSLPKVEIEEAKNDKLFIIV 152 TLP SVTKL L HLICD+ETAE W +FKPSL +++IE AK + LFIIV Sbjct: 751 TLPESVTKLMNLEHLICDQETAECW-EHFKPSLSELKIEVAKVN-LFIIV 798 >GAU49137.1 hypothetical protein TSUD_191390 [Trifolium subterraneum] Length = 864 Score = 57.4 bits (137), Expect = 1e-07 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +3 Query: 3 TLPGSVTKLERLLHLICDEETAEFWTRYFKPSLPKVEIEEAKNDKLFI 146 TLP S+TKL+ L HLICD+E AE W +FKPSLP + IEEA+ KLFI Sbjct: 817 TLPESITKLKNLKHLICDQEIAECW-EHFKPSLPNLIIEEAE-IKLFI 862