BLASTX nr result
ID: Glycyrrhiza32_contig00009159
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00009159 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SED44860.1 hypothetical protein SAMN05444164_4777 [Bradyrhizobiu... 50 2e-06 >SED44860.1 hypothetical protein SAMN05444164_4777 [Bradyrhizobium erythrophlei] Length = 70 Score = 50.4 bits (119), Expect = 2e-06 Identities = 25/44 (56%), Positives = 26/44 (59%) Frame = +3 Query: 51 HVVPAKAGTHNHGCRCLCTASPRVPHRGGAAHGSRPSPGRRVER 182 HVVPAKAGTHNH C SP VP AA+GSR PG R Sbjct: 27 HVVPAKAGTHNHRCEWRDKPSPLVPFPRAAAYGSRVKPGTTAGR 70