BLASTX nr result
ID: Glycyrrhiza32_contig00008468
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00008468 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007139047.1 hypothetical protein PHAVU_009G260500g [Phaseolus... 57 9e-08 >XP_007139047.1 hypothetical protein PHAVU_009G260500g [Phaseolus vulgaris] ESW11041.1 hypothetical protein PHAVU_009G260500g [Phaseolus vulgaris] Length = 1125 Score = 57.4 bits (137), Expect = 9e-08 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 2/78 (2%) Frame = -1 Query: 230 KDSIFSFHTGSILMKTEGTPSRRQRRPPT--KPIPSTSMHMLSKLTASVVVMIIVLLVES 57 KDSIFSF G +LM+ PS R P+ KP P +S++M+S L +V + VL + S Sbjct: 26 KDSIFSFW-GFVLMRA---PSPRGGPTPSTSKPTPPSSIYMISNL----MVFVTVLFLLS 77 Query: 56 CFLVPVEASSCEQVDRDS 3 FL+PV+A+SC Q+DRDS Sbjct: 78 SFLLPVQAASCNQLDRDS 95