BLASTX nr result
ID: Glycyrrhiza32_contig00008261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00008261 (612 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH35656.1 hypothetical protein GLYMA_10G256500 [Glycine max] KR... 53 1e-05 >KRH35656.1 hypothetical protein GLYMA_10G256500 [Glycine max] KRH35657.1 hypothetical protein GLYMA_10G256500 [Glycine max] Length = 109 Score = 52.8 bits (125), Expect = 1e-05 Identities = 28/53 (52%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = -1 Query: 234 MTGALAWQVKKVNKKVC-FGFWGRSHGELPGVSLWCVVCVIFSLSFCTLFSLY 79 M GALAWQVK +NKK F FWGRSHG + L CV+ F F L+ LY Sbjct: 1 MAGALAWQVKNINKKSNNFWFWGRSHGNSGLLPLVCVMFFFFLFFFFLLYYLY 53