BLASTX nr result
ID: Glycyrrhiza32_contig00007925
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00007925 (804 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019461443.1 PREDICTED: UBP1-associated protein 2A-like [Lupin... 95 2e-18 XP_012568616.1 PREDICTED: UBP1-associated protein 2B-like [Cicer... 92 1e-17 XP_019460492.1 PREDICTED: UBP1-associated protein 2A-like [Lupin... 92 1e-17 KYP73213.1 putative RNA-binding protein C660.15 family [Cajanus ... 92 2e-17 KHN38428.1 Putative RNA-binding protein [Glycine soja] 90 7e-17 XP_006575611.1 PREDICTED: UBP1-associated protein 2B-like [Glyci... 90 7e-17 XP_019455896.1 PREDICTED: UBP1-associated protein 2A-like [Lupin... 90 1e-16 KHN26020.1 Putative RNA-binding protein [Glycine soja] 89 2e-16 XP_019434416.1 PREDICTED: UBP1-associated protein 2B-like isofor... 89 2e-16 XP_019434393.1 PREDICTED: UBP1-associated protein 2A-like isofor... 89 2e-16 XP_003545465.1 PREDICTED: UBP1-associated protein 2B [Glycine ma... 89 2e-16 XP_014504658.1 PREDICTED: UBP1-associated protein 2B-like [Vigna... 87 8e-16 XP_017430383.1 PREDICTED: UBP1-associated protein 2B-like [Vigna... 87 8e-16 XP_007141558.1 hypothetical protein PHAVU_008G206200g [Phaseolus... 87 8e-16 XP_016166099.1 PREDICTED: UBP1-associated protein 2B-like [Arach... 86 3e-15 XP_015973467.1 PREDICTED: UBP1-associated protein 2B-like [Arach... 86 3e-15 XP_015873339.1 PREDICTED: UBP1-associated protein 2A-like [Zizip... 84 1e-14 XP_018831010.1 PREDICTED: UBP1-associated protein 2B-like [Jugla... 82 4e-14 XP_018815234.1 PREDICTED: UBP1-associated protein 2B-like [Jugla... 80 3e-13 XP_003617132.2 RNA recognition motif [Medicago truncatula] AET00... 79 6e-13 >XP_019461443.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] XP_019461444.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] XP_019461445.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] XP_019461446.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] XP_019461447.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] OIW01999.1 hypothetical protein TanjilG_00238 [Lupinus angustifolius] Length = 483 Score = 94.7 bits (234), Expect = 2e-18 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA +GNQ AM+YGNQQGMQ GYQNPQMGQSSGVRPHPGAGAPYMGH Sbjct: 438 PAGYGNQPAMNYGNQQGMQQGYQNPQMGQSSGVRPHPGAGAPYMGH 483 >XP_012568616.1 PREDICTED: UBP1-associated protein 2B-like [Cicer arietinum] XP_012568617.1 PREDICTED: UBP1-associated protein 2B-like [Cicer arietinum] Length = 494 Score = 92.4 bits (228), Expect = 1e-17 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PAA+GNQAAM YGNQ G+QP YQNPQMGQSSGVRPHPG GAPYMGH Sbjct: 449 PAAYGNQAAMGYGNQPGLQPQYQNPQMGQSSGVRPHPGPGAPYMGH 494 >XP_019460492.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] XP_019460493.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] XP_019460494.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] OIW02788.1 hypothetical protein TanjilG_29564 [Lupinus angustifolius] Length = 480 Score = 92.0 bits (227), Expect = 1e-17 Identities = 40/46 (86%), Positives = 42/46 (91%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA +GNQ AM+YGNQQGMQ GYQNPQMGQSSG RPHPGAGAPYMGH Sbjct: 435 PAGYGNQPAMNYGNQQGMQQGYQNPQMGQSSGGRPHPGAGAPYMGH 480 >KYP73213.1 putative RNA-binding protein C660.15 family [Cajanus cajan] Length = 488 Score = 92.0 bits (227), Expect = 2e-17 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA++GNQ AM YGNQ MQPGYQNPQMGQ+SGVRPHPGAGAPYMGH Sbjct: 443 PASYGNQPAMGYGNQPAMQPGYQNPQMGQNSGVRPHPGAGAPYMGH 488 >KHN38428.1 Putative RNA-binding protein [Glycine soja] Length = 496 Score = 90.1 bits (222), Expect = 7e-17 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA + NQ AM YGNQ MQPGYQNPQMGQSSGVRPHPGAGAPYMGH Sbjct: 451 PAPYANQPAMGYGNQPAMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 496 >XP_006575611.1 PREDICTED: UBP1-associated protein 2B-like [Glycine max] XP_014625731.1 PREDICTED: UBP1-associated protein 2B-like [Glycine max] XP_014625732.1 PREDICTED: UBP1-associated protein 2B-like [Glycine max] KRH73477.1 hypothetical protein GLYMA_02G275400 [Glycine max] Length = 496 Score = 90.1 bits (222), Expect = 7e-17 Identities = 39/46 (84%), Positives = 40/46 (86%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA + NQ AM YGNQ MQPGYQNPQMGQSSGVRPHPGAGAPYMGH Sbjct: 451 PAPYANQPAMGYGNQPAMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 496 >XP_019455896.1 PREDICTED: UBP1-associated protein 2A-like [Lupinus angustifolius] OIW04165.1 hypothetical protein TanjilG_00725 [Lupinus angustifolius] Length = 497 Score = 89.7 bits (221), Expect = 1e-16 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA +GNQ M+YGNQ GMQ GYQNPQMGQ+SGVRPHPGAGAPYMGH Sbjct: 452 PAGYGNQPTMNYGNQPGMQQGYQNPQMGQNSGVRPHPGAGAPYMGH 497 >KHN26020.1 Putative RNA-binding protein [Glycine soja] Length = 433 Score = 88.6 bits (218), Expect = 2e-16 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA + NQ AM YGNQ MQPGYQNPQMGQ SGVRPHPGAGAPYMGH Sbjct: 388 PAPYANQPAMGYGNQPAMQPGYQNPQMGQGSGVRPHPGAGAPYMGH 433 >XP_019434416.1 PREDICTED: UBP1-associated protein 2B-like isoform X2 [Lupinus angustifolius] Length = 474 Score = 88.6 bits (218), Expect = 2e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 801 AAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 A +GNQ AM+YGNQ GMQ GYQNPQMGQ+SGVRPHPGAGAPYMGH Sbjct: 430 AGYGNQPAMNYGNQPGMQQGYQNPQMGQNSGVRPHPGAGAPYMGH 474 >XP_019434393.1 PREDICTED: UBP1-associated protein 2A-like isoform X1 [Lupinus angustifolius] XP_019434397.1 PREDICTED: UBP1-associated protein 2A-like isoform X1 [Lupinus angustifolius] XP_019434412.1 PREDICTED: UBP1-associated protein 2A-like isoform X1 [Lupinus angustifolius] OIW16265.1 hypothetical protein TanjilG_18980 [Lupinus angustifolius] Length = 488 Score = 88.6 bits (218), Expect = 2e-16 Identities = 38/45 (84%), Positives = 41/45 (91%) Frame = -1 Query: 801 AAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 A +GNQ AM+YGNQ GMQ GYQNPQMGQ+SGVRPHPGAGAPYMGH Sbjct: 444 AGYGNQPAMNYGNQPGMQQGYQNPQMGQNSGVRPHPGAGAPYMGH 488 >XP_003545465.1 PREDICTED: UBP1-associated protein 2B [Glycine max] XP_006595801.1 PREDICTED: UBP1-associated protein 2B [Glycine max] XP_006595802.1 PREDICTED: UBP1-associated protein 2B [Glycine max] KRH14673.1 hypothetical protein GLYMA_14G040800 [Glycine max] KRH14674.1 hypothetical protein GLYMA_14G040800 [Glycine max] Length = 494 Score = 88.6 bits (218), Expect = 2e-16 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA + NQ AM YGNQ MQPGYQNPQMGQ SGVRPHPGAGAPYMGH Sbjct: 449 PAPYANQPAMGYGNQPAMQPGYQNPQMGQGSGVRPHPGAGAPYMGH 494 >XP_014504658.1 PREDICTED: UBP1-associated protein 2B-like [Vigna radiata var. radiata] XP_014504659.1 PREDICTED: UBP1-associated protein 2B-like [Vigna radiata var. radiata] Length = 494 Score = 87.0 bits (214), Expect = 8e-16 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA +GNQ AM YGNQ MQ GYQNPQMGQSS VRPHPGAGAPYMGH Sbjct: 449 PAPYGNQPAMGYGNQPAMQQGYQNPQMGQSSAVRPHPGAGAPYMGH 494 >XP_017430383.1 PREDICTED: UBP1-associated protein 2B-like [Vigna angularis] KOM46704.1 hypothetical protein LR48_Vigan07g040800 [Vigna angularis] BAT80918.1 hypothetical protein VIGAN_03054500 [Vigna angularis var. angularis] Length = 494 Score = 87.0 bits (214), Expect = 8e-16 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA +GNQ AM YGNQ MQ GYQNPQMGQSS VRPHPGAGAPYMGH Sbjct: 449 PAPYGNQPAMGYGNQPAMQQGYQNPQMGQSSAVRPHPGAGAPYMGH 494 >XP_007141558.1 hypothetical protein PHAVU_008G206200g [Phaseolus vulgaris] ESW13552.1 hypothetical protein PHAVU_008G206200g [Phaseolus vulgaris] Length = 494 Score = 87.0 bits (214), Expect = 8e-16 Identities = 38/46 (82%), Positives = 39/46 (84%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA +GNQ AM YGNQ MQ GYQNPQMGQ SGVRPHPGAGAPYMGH Sbjct: 449 PAPYGNQPAMGYGNQPAMQQGYQNPQMGQISGVRPHPGAGAPYMGH 494 >XP_016166099.1 PREDICTED: UBP1-associated protein 2B-like [Arachis ipaensis] XP_016166100.1 PREDICTED: UBP1-associated protein 2B-like [Arachis ipaensis] Length = 516 Score = 85.5 bits (210), Expect = 3e-15 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -1 Query: 795 FGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 +G Q AM YGNQ GMQP YQNPQMGQSSGVRPHPGAGAPYMGH Sbjct: 474 YGTQPAMGYGNQPGMQPQYQNPQMGQSSGVRPHPGAGAPYMGH 516 >XP_015973467.1 PREDICTED: UBP1-associated protein 2B-like [Arachis duranensis] XP_015973468.1 PREDICTED: UBP1-associated protein 2B-like [Arachis duranensis] Length = 518 Score = 85.5 bits (210), Expect = 3e-15 Identities = 37/43 (86%), Positives = 38/43 (88%) Frame = -1 Query: 795 FGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 +G Q AM YGNQ GMQP YQNPQMGQSSGVRPHPGAGAPYMGH Sbjct: 476 YGTQPAMGYGNQPGMQPQYQNPQMGQSSGVRPHPGAGAPYMGH 518 >XP_015873339.1 PREDICTED: UBP1-associated protein 2A-like [Ziziphus jujuba] XP_015873340.1 PREDICTED: UBP1-associated protein 2A-like [Ziziphus jujuba] XP_015873341.1 PREDICTED: UBP1-associated protein 2A-like [Ziziphus jujuba] XP_015873342.1 PREDICTED: UBP1-associated protein 2A-like [Ziziphus jujuba] Length = 507 Score = 84.0 bits (206), Expect = 1e-14 Identities = 37/46 (80%), Positives = 38/46 (82%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 P +GNQA SYGNQ GMQ GYQNPQMGQSS RPHPGAGAPYMGH Sbjct: 462 PVGYGNQAGGSYGNQPGMQGGYQNPQMGQSSAGRPHPGAGAPYMGH 507 >XP_018831010.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018831011.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018831012.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018831013.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] Length = 494 Score = 82.0 bits (201), Expect = 4e-14 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA +GNQA SYGNQQ MQ GYQNPQMGQS VRPHPG+G PYMGH Sbjct: 449 PAGYGNQAGGSYGNQQLMQGGYQNPQMGQSGAVRPHPGSGPPYMGH 494 >XP_018815234.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018815235.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] XP_018815236.1 PREDICTED: UBP1-associated protein 2B-like [Juglans regia] Length = 483 Score = 79.7 bits (195), Expect = 3e-13 Identities = 35/46 (76%), Positives = 37/46 (80%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPGAGAPYMGH 667 PA +GNQA SYGNQ MQ GY NPQMGQSS VRPHPG+G PYMGH Sbjct: 438 PAGYGNQAGGSYGNQSLMQGGYHNPQMGQSSAVRPHPGSGPPYMGH 483 >XP_003617132.2 RNA recognition motif [Medicago truncatula] AET00091.2 RNA recognition motif [Medicago truncatula] Length = 497 Score = 78.6 bits (192), Expect = 6e-13 Identities = 37/47 (78%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -1 Query: 804 PAAFGNQAAMSYGNQQGMQPGYQNPQMGQSSGVRPHPG-AGAPYMGH 667 PAA+GNQAAM YG Q G+QP YQNPQ+GQS GVRPHPG GAPYMGH Sbjct: 452 PAAYGNQAAMGYG-QPGLQPQYQNPQLGQSGGVRPHPGPGGAPYMGH 497