BLASTX nr result
ID: Glycyrrhiza32_contig00007910
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00007910 (207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004511327.2 PREDICTED: uncharacterized protein LOC101500396 [... 62 9e-10 GAU24856.1 hypothetical protein TSUD_115790 [Trifolium subterran... 60 3e-09 XP_003610653.1 cysteine-rich receptor-kinase-like protein [Medic... 59 1e-08 >XP_004511327.2 PREDICTED: uncharacterized protein LOC101500396 [Cicer arietinum] Length = 1461 Score = 62.4 bits (150), Expect = 9e-10 Identities = 31/54 (57%), Positives = 39/54 (72%) Frame = -3 Query: 163 LASLFLFFGFPITTEAASSPTYVGTRCNDNTTYAPDSKLGSNLNVLLYSLTTNA 2 L SLF+F + A S+ TY+G+ CN+NTTY P+S L +NLNVLL SLTTNA Sbjct: 10 LTSLFVFDLLYLILTAESAATYIGSNCNNNTTYTPNSILSTNLNVLLNSLTTNA 63 >GAU24856.1 hypothetical protein TSUD_115790 [Trifolium subterraneum] Length = 211 Score = 59.7 bits (143), Expect = 3e-09 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = -3 Query: 148 LFFGFPITTEAASSPTYVGTRCNDNTTYAPDSKLGSNLNVLLYSLTTNA 2 LF +T +SPTY+G+ CNDNTTY P++ L +N+NVLL SLTTNA Sbjct: 5 LFSLLYLTLAIQASPTYIGSYCNDNTTYLPNTTLDTNINVLLNSLTTNA 53 >XP_003610653.1 cysteine-rich receptor-kinase-like protein [Medicago truncatula] AES93611.1 cysteine-rich receptor-kinase-like protein [Medicago truncatula] Length = 657 Score = 58.9 bits (141), Expect = 1e-08 Identities = 31/56 (55%), Positives = 41/56 (73%) Frame = -3 Query: 169 YALASLFLFFGFPITTEAASSPTYVGTRCNDNTTYAPDSKLGSNLNVLLYSLTTNA 2 Y ++ L+L + TEA SPTY+G+ CNDNTTY P+S L +NLNVLL SL+TN+ Sbjct: 12 YVVSILYLTL---LATEA--SPTYLGSYCNDNTTYTPNSTLSTNLNVLLNSLSTNS 62