BLASTX nr result
ID: Glycyrrhiza32_contig00007416
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00007416 (354 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU14820.1 hypothetical protein TSUD_50320 [Trifolium subterraneum] 43 1e-06 >GAU14820.1 hypothetical protein TSUD_50320 [Trifolium subterraneum] Length = 310 Score = 42.7 bits (99), Expect(2) = 1e-06 Identities = 24/52 (46%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +2 Query: 149 ATVFEKLRLSIDLASHHP-LPLGKNHQLQQNASLQGLEITTNKIPFHQHNGI 301 AT K RLS++LA+H P + + ++Q +GL+ITTNKIPFHQ N + Sbjct: 20 ATGSGKSRLSVELATHFPYFEIINSDKIQV---YKGLDITTNKIPFHQRNNV 68 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +1 Query: 292 QWHPLPHHLLGDVNPSHSEFS 354 Q + +PHHLLGDV+PSH EFS Sbjct: 64 QRNNVPHHLLGDVDPSHGEFS 84