BLASTX nr result
ID: Glycyrrhiza32_contig00007406
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00007406 (202 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004504503.1 PREDICTED: metalloendoproteinase 1 [Cicer arietinum] 53 1e-06 XP_019445498.1 PREDICTED: metalloendoproteinase 2-MMP [Lupinus a... 52 5e-06 >XP_004504503.1 PREDICTED: metalloendoproteinase 1 [Cicer arietinum] Length = 374 Score = 53.1 bits (126), Expect = 1e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +3 Query: 54 MSFRYNFLFALAIVTSTLSITFPSVSARFFPNASSIPTDISKHAPQGAW 200 MS + + + LAI+T +S+T VSARFFPN SSIPT +S +AP GAW Sbjct: 1 MSTQNQYYYTLAILT-LISVTLSPVSARFFPNPSSIPTWMSNNAPPGAW 48 >XP_019445498.1 PREDICTED: metalloendoproteinase 2-MMP [Lupinus angustifolius] OIW10534.1 hypothetical protein TanjilG_15906 [Lupinus angustifolius] Length = 378 Score = 51.6 bits (122), Expect = 5e-06 Identities = 27/51 (52%), Positives = 36/51 (70%) Frame = +3 Query: 48 PNMSFRYNFLFALAIVTSTLSITFPSVSARFFPNASSIPTDISKHAPQGAW 200 P+ + + +LF+ AI+ LS++ SVSAR FPN SSIPT IS +A QGAW Sbjct: 3 PHSCYHHCYLFS-AIIIIFLSLSATSVSARLFPNVSSIPTWISNNATQGAW 52