BLASTX nr result
ID: Glycyrrhiza32_contig00007080
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00007080 (609 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN02071.1 Cytochrome P450 83B1 [Glycine soja] 99 1e-20 XP_003516815.1 PREDICTED: cytochrome P450 83B1-like [Glycine max... 99 2e-20 KHN19810.1 Cytochrome P450 83B1 [Glycine soja] 97 4e-20 XP_003551894.1 PREDICTED: cytochrome P450 83B1-like [Glycine max... 97 7e-20 CAD31843.1 putative cytochrome P450 monooxygenase, partial [Cice... 88 7e-19 XP_003615840.1 cytochrome P450 family protein, putative [Medicag... 85 1e-18 XP_004490658.1 PREDICTED: cytochrome P450 83B1-like [Cicer ariet... 92 4e-18 XP_014496747.1 PREDICTED: cytochrome P450 83B1-like [Vigna radia... 90 1e-17 XP_003615837.2 cytochrome P450 family 71 protein [Medicago trunc... 89 5e-17 AFK34313.1 unknown [Medicago truncatula] 89 5e-17 XP_004490657.1 PREDICTED: cytochrome P450 83B1-like [Cicer ariet... 88 9e-17 KYP46473.1 Cytochrome P450 83B1 [Cajanus cajan] 87 1e-16 XP_017416654.1 PREDICTED: cytochrome P450 83B1-like [Vigna angul... 87 1e-16 XP_013455092.1 cytochrome P450 family 71 protein [Medicago trunc... 86 3e-16 XP_011077701.1 PREDICTED: cytochrome P450 71A1-like [Sesamum ind... 86 4e-16 ABD97102.1 cytochrome P450 monooxygenase CYP83G2 [Medicago trunc... 86 4e-16 XP_003615846.2 cytochrome P450 family 71 protein [Medicago trunc... 86 4e-16 NP_001240228.1 cytochrome P450 83B1-like precursor [Glycine max]... 86 6e-16 XP_015169399.1 PREDICTED: cytochrome P450 83B1-like [Solanum tub... 84 8e-16 XP_011077693.1 PREDICTED: cytochrome P450 83B1-like [Sesamum ind... 85 8e-16 >KHN02071.1 Cytochrome P450 83B1 [Glycine soja] Length = 497 Score = 98.6 bits (244), Expect = 1e-20 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 MG+ TVELVLA+LLYSFDWEMPQG KREDIDT++LPGLIQHKK+PLCLVAKK+ Sbjct: 444 MGIITVELVLANLLYSFDWEMPQGMKREDIDTDMLPGLIQHKKNPLCLVAKKQ 496 >XP_003516815.1 PREDICTED: cytochrome P450 83B1-like [Glycine max] KRH75322.1 hypothetical protein GLYMA_01G078300 [Glycine max] Length = 501 Score = 98.6 bits (244), Expect = 2e-20 Identities = 45/53 (84%), Positives = 51/53 (96%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 MG+ TVELVLA+LLYSFDWEMPQG KREDIDT++LPGLIQHKK+PLCLVAKK+ Sbjct: 448 MGIITVELVLANLLYSFDWEMPQGMKREDIDTDMLPGLIQHKKNPLCLVAKKQ 500 >KHN19810.1 Cytochrome P450 83B1 [Glycine soja] Length = 412 Score = 96.7 bits (239), Expect = 4e-20 Identities = 43/53 (81%), Positives = 51/53 (96%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 MG+ TVELVLA+LLYSFDWEMPQG +R+DIDT++LPGL+QHKK+PLCLVAKKR Sbjct: 359 MGIITVELVLANLLYSFDWEMPQGMERKDIDTDMLPGLVQHKKNPLCLVAKKR 411 >XP_003551894.1 PREDICTED: cytochrome P450 83B1-like [Glycine max] KRG98820.1 hypothetical protein GLYMA_18G100500 [Glycine max] Length = 501 Score = 96.7 bits (239), Expect = 7e-20 Identities = 43/53 (81%), Positives = 51/53 (96%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 MG+ TVELVLA+LLYSFDWEMPQG +R+DIDT++LPGL+QHKK+PLCLVAKKR Sbjct: 448 MGIITVELVLANLLYSFDWEMPQGMERKDIDTDMLPGLVQHKKNPLCLVAKKR 500 >CAD31843.1 putative cytochrome P450 monooxygenase, partial [Cicer arietinum] Length = 128 Score = 87.8 bits (216), Expect = 7e-19 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 M VATVELVLA+LLY FDWEMP+G K EDID + LPGLI+HKKHPL LVAKKR Sbjct: 72 MAVATVELVLANLLYLFDWEMPEGVKSEDIDIDGLPGLIKHKKHPLYLVAKKR 124 >XP_003615840.1 cytochrome P450 family protein, putative [Medicago truncatula] AES98798.1 cytochrome P450 family protein, putative [Medicago truncatula] Length = 57 Score = 85.1 bits (209), Expect = 1e-18 Identities = 39/53 (73%), Positives = 46/53 (86%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 M +AT++LVL++LL SFDWEMP+G KREDIDT GLIQHKK+PLCLVAKKR Sbjct: 1 MAIATIDLVLSNLLCSFDWEMPEGAKREDIDTHGQAGLIQHKKNPLCLVAKKR 53 >XP_004490658.1 PREDICTED: cytochrome P450 83B1-like [Cicer arietinum] Length = 503 Score = 91.7 bits (226), Expect = 4e-18 Identities = 42/53 (79%), Positives = 47/53 (88%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 M VATVELVLA+LLY FDWEMP+G K EDID + LPGL++HKKHPLCLVAKKR Sbjct: 445 MAVATVELVLANLLYLFDWEMPEGVKSEDIDIDGLPGLVKHKKHPLCLVAKKR 497 >XP_014496747.1 PREDICTED: cytochrome P450 83B1-like [Vigna radiata var. radiata] Length = 501 Score = 90.1 bits (222), Expect = 1e-17 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 MGV T+ELVLA+LL+SFDWE+PQG KR+DIDT++LPGLIQHKK PL LVAKKR Sbjct: 448 MGVITMELVLANLLHSFDWELPQGMKRDDIDTDMLPGLIQHKKTPLILVAKKR 500 >XP_003615837.2 cytochrome P450 family 71 protein [Medicago truncatula] XP_003615842.2 cytochrome P450 family 71 protein [Medicago truncatula] ABC59084.1 cytochrome P450 monooxygenase CYP83G1 [Medicago truncatula] AES98795.2 cytochrome P450 family 71 protein [Medicago truncatula] AES98800.2 cytochrome P450 family 71 protein [Medicago truncatula] Length = 506 Score = 88.6 bits (218), Expect = 5e-17 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 M +AT++LVL++LLYSFDWEMP+G KREDIDT GLIQHKK+PLCLVAKKR Sbjct: 450 MAIATIDLVLSNLLYSFDWEMPEGAKREDIDTHGQAGLIQHKKNPLCLVAKKR 502 >AFK34313.1 unknown [Medicago truncatula] Length = 506 Score = 88.6 bits (218), Expect = 5e-17 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 M +AT++LVL++LLYSFDWEMP+G KREDIDT GLIQHKK+PLCLVAKKR Sbjct: 450 MAIATIDLVLSNLLYSFDWEMPEGAKREDIDTHGQAGLIQHKKNPLCLVAKKR 502 >XP_004490657.1 PREDICTED: cytochrome P450 83B1-like [Cicer arietinum] Length = 501 Score = 87.8 bits (216), Expect = 9e-17 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 M VATVELVLA+LLY FDWEMP+G K EDID + LPGLI+HKKHPL LVAKKR Sbjct: 445 MAVATVELVLANLLYLFDWEMPEGVKSEDIDIDGLPGLIKHKKHPLYLVAKKR 497 >KYP46473.1 Cytochrome P450 83B1 [Cajanus cajan] Length = 498 Score = 87.4 bits (215), Expect = 1e-16 Identities = 38/53 (71%), Positives = 49/53 (92%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 MG+A+++L+LA+LL SFDWE+P+G KREDIDTEVLPGL QHKK+PLC++AK R Sbjct: 445 MGIASLDLILANLLNSFDWELPEGMKREDIDTEVLPGLAQHKKNPLCILAKCR 497 >XP_017416654.1 PREDICTED: cytochrome P450 83B1-like [Vigna angularis] KOM38235.1 hypothetical protein LR48_Vigan03g161700 [Vigna angularis] BAT84659.1 hypothetical protein VIGAN_04209000 [Vigna angularis var. angularis] Length = 500 Score = 87.4 bits (215), Expect = 1e-16 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 MGV T ELVLA+LL+SFDW++PQG K +DIDT++LPGLIQHKK+PL LVAKKR Sbjct: 447 MGVMTTELVLANLLHSFDWDLPQGMKSDDIDTDMLPGLIQHKKNPLILVAKKR 499 >XP_013455092.1 cytochrome P450 family 71 protein [Medicago truncatula] KEH29140.1 cytochrome P450 family 71 protein [Medicago truncatula] Length = 497 Score = 86.3 bits (212), Expect = 3e-16 Identities = 38/51 (74%), Positives = 46/51 (90%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAK 456 MGVA+VEL+LA+LLYSFDW++P G +EDIDTE LPG+ QHKK+PLCLVAK Sbjct: 444 MGVASVELILANLLYSFDWKLPHGLVKEDIDTETLPGITQHKKNPLCLVAK 494 >XP_011077701.1 PREDICTED: cytochrome P450 71A1-like [Sesamum indicum] Length = 501 Score = 85.9 bits (211), Expect = 4e-16 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKK 453 MG+ATVEL LA+LLY+FDWE+P G KREDIDT VLPGL HKK+PLCLV K+ Sbjct: 444 MGLATVELALANLLYTFDWELPAGMKREDIDTAVLPGLTMHKKNPLCLVPKQ 495 >ABD97102.1 cytochrome P450 monooxygenase CYP83G2 [Medicago truncatula] Length = 502 Score = 85.9 bits (211), Expect = 4e-16 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 M +ATV+LVLA+LLY FDWEMP+G K E+ID + LPGL+QHKK+PLCL+AKKR Sbjct: 446 MAIATVDLVLANLLYLFDWEMPEGVKWENIDIDGLPGLVQHKKNPLCLIAKKR 498 >XP_003615846.2 cytochrome P450 family 71 protein [Medicago truncatula] AES98804.2 cytochrome P450 family 71 protein [Medicago truncatula] Length = 506 Score = 85.9 bits (211), Expect = 4e-16 Identities = 38/53 (71%), Positives = 47/53 (88%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKKR 450 M +ATV+LVLA+LLY FDWEMP+G K E+ID + LPGL+QHKK+PLCL+AKKR Sbjct: 450 MAIATVDLVLANLLYLFDWEMPEGVKWENIDIDGLPGLVQHKKNPLCLIAKKR 502 >NP_001240228.1 cytochrome P450 83B1-like precursor [Glycine max] ABC68397.1 cytochrome P450 monooxygenase CYP83E8 [Glycine max] KHN35611.1 Cytochrome P450 83B1 [Glycine soja] KRH65359.1 hypothetical protein GLYMA_03G029900 [Glycine max] Length = 499 Score = 85.5 bits (210), Expect = 6e-16 Identities = 37/51 (72%), Positives = 46/51 (90%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAK 456 M A ++L+LA+LLYSFDWE+PQG K+EDIDTEVLPG+ QHKK+PLC+VAK Sbjct: 446 MAFAALDLILANLLYSFDWELPQGMKKEDIDTEVLPGVTQHKKNPLCVVAK 496 >XP_015169399.1 PREDICTED: cytochrome P450 83B1-like [Solanum tuberosum] Length = 289 Score = 83.6 bits (205), Expect = 8e-16 Identities = 36/51 (70%), Positives = 46/51 (90%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAK 456 +GVATVELVL++LLY+FDWE+P+G +EDIDT+VLPGL HKK PLCLV++ Sbjct: 236 LGVATVELVLSNLLYAFDWELPRGMNKEDIDTDVLPGLTMHKKKPLCLVSR 286 >XP_011077693.1 PREDICTED: cytochrome P450 83B1-like [Sesamum indicum] Length = 511 Score = 85.1 bits (209), Expect = 8e-16 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 608 MGVATVELVLASLLYSFDWEMPQGTKREDIDTEVLPGLIQHKKHPLCLVAKK 453 MG+ATVEL LA+LLY+FDWE+P G KREDIDT VLPG+ HKK+PLCLV K+ Sbjct: 456 MGLATVELALANLLYTFDWELPAGMKREDIDTAVLPGITMHKKNPLCLVPKQ 507