BLASTX nr result
ID: Glycyrrhiza32_contig00007075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00007075 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP52842.1 Ethylene-responsive transcription factor RAP2-4 [Caja... 60 4e-08 >KYP52842.1 Ethylene-responsive transcription factor RAP2-4 [Cajanus cajan] Length = 331 Score = 60.1 bits (144), Expect = 4e-08 Identities = 30/38 (78%), Positives = 31/38 (81%), Gaps = 3/38 (7%) Frame = -2 Query: 167 MTHHVFTDELSY---NSQNLIGFGQPTSLLGLNHLTPS 63 MTHHVF D LS N+QNLIG GQPTSLLGLNHLTPS Sbjct: 66 MTHHVFADGLSLSFPNTQNLIGLGQPTSLLGLNHLTPS 103