BLASTX nr result
ID: Glycyrrhiza32_contig00006844
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00006844 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019447383.1 PREDICTED: mitochondrial arginine transporter BAC... 59 8e-08 XP_013457221.1 substrate carrier family protein [Medicago trunca... 55 2e-06 AFK33461.1 unknown [Medicago truncatula] 55 2e-06 GAU24121.1 hypothetical protein TSUD_83560 [Trifolium subterraneum] 55 2e-06 KYP61118.1 hypothetical protein KK1_023542 [Cajanus cajan] 55 2e-06 XP_004504764.1 PREDICTED: mitochondrial carrier protein MTM1 [Ci... 55 3e-06 >XP_019447383.1 PREDICTED: mitochondrial arginine transporter BAC2 [Lupinus angustifolius] OIW18982.1 hypothetical protein TanjilG_23759 [Lupinus angustifolius] Length = 380 Score = 59.3 bits (142), Expect = 8e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -2 Query: 373 GIGLRMARSGFASFMIVGSYFFVVDRLASSLT 278 GIGLRMARSGFASFMIVGSYFF+VD LAS+L+ Sbjct: 349 GIGLRMARSGFASFMIVGSYFFIVDHLASTLS 380 >XP_013457221.1 substrate carrier family protein [Medicago truncatula] KEH31252.1 substrate carrier family protein [Medicago truncatula] Length = 381 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 373 GIGLRMARSGFASFMIVGSYFFVVDRLASSLT 278 G+GLRMARSG ASFMIVGSY FVVD L SSLT Sbjct: 350 GLGLRMARSGIASFMIVGSYLFVVDHLTSSLT 381 >AFK33461.1 unknown [Medicago truncatula] Length = 381 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 373 GIGLRMARSGFASFMIVGSYFFVVDRLASSLT 278 G+GLRMARSG ASFMIVGSY FVVD L SSLT Sbjct: 350 GLGLRMARSGIASFMIVGSYLFVVDHLTSSLT 381 >GAU24121.1 hypothetical protein TSUD_83560 [Trifolium subterraneum] Length = 380 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 373 GIGLRMARSGFASFMIVGSYFFVVDRLASSLT 278 G+GLRMARSG ASFMIVGSY F VD LASSLT Sbjct: 349 GLGLRMARSGVASFMIVGSYLFAVDHLASSLT 380 >KYP61118.1 hypothetical protein KK1_023542 [Cajanus cajan] Length = 380 Score = 55.1 bits (131), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -2 Query: 373 GIGLRMARSGFASFMIVGSYFFVVDRLASSLT 278 GIG RMARSG ASF+IVGSYFFV D LASSLT Sbjct: 349 GIGWRMARSGLASFLIVGSYFFVADHLASSLT 380 >XP_004504764.1 PREDICTED: mitochondrial carrier protein MTM1 [Cicer arietinum] XP_004504765.1 PREDICTED: mitochondrial carrier protein MTM1 [Cicer arietinum] Length = 379 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -2 Query: 373 GIGLRMARSGFASFMIVGSYFFVVDRLASSL 281 GIGLRMARSG AS MIVGSYFFVVD LAS+L Sbjct: 348 GIGLRMARSGIASIMIVGSYFFVVDHLASNL 378