BLASTX nr result
ID: Glycyrrhiza32_contig00006707
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00006707 (316 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP52842.1 Ethylene-responsive transcription factor RAP2-4 [Caja... 61 1e-08 NP_001236953.1 dehydration responsive element-binding protein 3 ... 59 6e-08 ALA09100.1 AP2-EREBP transcription factor, partial [Glycine max]... 59 7e-08 XP_019433166.1 PREDICTED: ethylene-responsive transcription fact... 59 7e-08 XP_019417344.1 PREDICTED: ethylene-responsive transcription fact... 59 7e-08 XP_007136233.1 hypothetical protein PHAVU_009G029600g [Phaseolus... 58 1e-07 ADD69957.1 DREB2 [Caragana korshinskii] 57 2e-07 XP_013460867.1 ethylene response factor [Medicago truncatula] AE... 57 2e-07 XP_014501813.1 PREDICTED: ethylene-responsive transcription fact... 57 2e-07 XP_017422614.1 PREDICTED: ethylene-responsive transcription fact... 57 2e-07 XP_019430857.1 PREDICTED: ethylene-responsive transcription fact... 57 2e-07 XP_004500614.1 PREDICTED: ethylene-responsive transcription fact... 56 5e-07 XP_003526587.1 PREDICTED: ethylene-responsive transcription fact... 56 6e-07 GAU24550.1 hypothetical protein TSUD_148910 [Trifolium subterran... 55 8e-07 AEI16474.1 dehydration-responsive element binding protein [Lespe... 55 8e-07 ACJ83281.1 unknown, partial [Medicago truncatula] 52 3e-06 XP_019461680.1 PREDICTED: ethylene-responsive transcription fact... 54 4e-06 >KYP52842.1 Ethylene-responsive transcription factor RAP2-4 [Cajanus cajan] Length = 331 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 186 NSQNLKGFGQPTSLLGLNHLTPSQINQIQAQIQ 284 N+QNL G GQPTSLLGLNHLTPSQI+QIQAQIQ Sbjct: 81 NTQNLIGLGQPTSLLGLNHLTPSQISQIQAQIQ 113 >NP_001236953.1 dehydration responsive element-binding protein 3 [Glycine max] AAZ03388.1 dehydration responsive element-binding protein 3 [Glycine max] Length = 272 Score = 58.5 bits (140), Expect = 6e-08 Identities = 30/38 (78%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = +3 Query: 189 SQNLKGFGQ--PTSLLGLNHLTPSQINQIQAQIQHPNH 296 +QNL GFGQ PTSL+GLNHLTPSQI+QIQAQIQ NH Sbjct: 75 TQNLIGFGQGQPTSLVGLNHLTPSQISQIQAQIQIQNH 112 >ALA09100.1 AP2-EREBP transcription factor, partial [Glycine max] KRH62373.1 hypothetical protein GLYMA_04G103900 [Glycine max] Length = 314 Score = 58.5 bits (140), Expect = 7e-08 Identities = 30/38 (78%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = +3 Query: 189 SQNLKGFGQ--PTSLLGLNHLTPSQINQIQAQIQHPNH 296 +QNL GFGQ PTSL+GLNHLTPSQI+QIQAQIQ NH Sbjct: 75 TQNLIGFGQGQPTSLVGLNHLTPSQISQIQAQIQIQNH 112 >XP_019433166.1 PREDICTED: ethylene-responsive transcription factor RAP2-4-like [Lupinus angustifolius] XP_019433167.1 PREDICTED: ethylene-responsive transcription factor RAP2-4-like [Lupinus angustifolius] OIW21483.1 hypothetical protein TanjilG_04964 [Lupinus angustifolius] Length = 349 Score = 58.5 bits (140), Expect = 7e-08 Identities = 31/48 (64%), Positives = 35/48 (72%), Gaps = 4/48 (8%) Frame = +3 Query: 180 SYNSQNLKGFGQ----PTSLLGLNHLTPSQINQIQAQIQHPNHLTWQH 311 S N+QN GFGQ P+SLLGLNHLTPSQINQIQAQ+ N +QH Sbjct: 84 SSNNQNFIGFGQFGSSPSSLLGLNHLTPSQINQIQAQMHLQNMQNFQH 131 >XP_019417344.1 PREDICTED: ethylene-responsive transcription factor RAP2-4-like [Lupinus angustifolius] OIV96712.1 hypothetical protein TanjilG_09254 [Lupinus angustifolius] Length = 360 Score = 58.5 bits (140), Expect = 7e-08 Identities = 32/48 (66%), Positives = 35/48 (72%), Gaps = 5/48 (10%) Frame = +3 Query: 180 SYNSQNLKGFGQ-----PTSLLGLNHLTPSQINQIQAQIQHPNHLTWQ 308 SYNSQN+ GF Q P+SLLGLNHLTPSQINQIQAQI N +Q Sbjct: 86 SYNSQNIIGFEQLCSSSPSSLLGLNHLTPSQINQIQAQIHLQNMQNFQ 133 >XP_007136233.1 hypothetical protein PHAVU_009G029600g [Phaseolus vulgaris] ESW08227.1 hypothetical protein PHAVU_009G029600g [Phaseolus vulgaris] Length = 353 Score = 57.8 bits (138), Expect = 1e-07 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = +3 Query: 186 NSQNLKGF--GQPTSLLGLNHLTPSQINQIQAQIQHPNHLTWQHQ 314 N+QN+ GF GQPTSLLGLNHLTPSQI+QIQAQIQ + QHQ Sbjct: 92 NTQNIIGFAQGQPTSLLGLNHLTPSQISQIQAQIQ----IQSQHQ 132 >ADD69957.1 DREB2 [Caragana korshinskii] Length = 323 Score = 57.4 bits (137), Expect = 2e-07 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = +3 Query: 201 KGFGQPTSLLGLNHLTPSQINQIQAQIQHPNH 296 KGFGQP S+LGLNHLTPSQINQIQAQIQ H Sbjct: 82 KGFGQPNSVLGLNHLTPSQINQIQAQIQLQAH 113 >XP_013460867.1 ethylene response factor [Medicago truncatula] AEX93413.1 putative AP2/EREBP transcription factor [Medicago truncatula] KEH34901.1 ethylene response factor [Medicago truncatula] Length = 340 Score = 57.4 bits (137), Expect = 2e-07 Identities = 32/50 (64%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = +3 Query: 183 YNSQNLKGFGQPTS------LLGLNHLTPSQINQIQAQIQHPNHLTWQHQ 314 Y QN GF QP+S LLGLNHLTPSQINQIQ QIQ N T QHQ Sbjct: 63 YTEQNFIGFAQPSSSFSSPSLLGLNHLTPSQINQIQVQIQQQN-FTMQHQ 111 >XP_014501813.1 PREDICTED: ethylene-responsive transcription factor RAP2-4-like [Vigna radiata var. radiata] Length = 349 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/35 (82%), Positives = 32/35 (91%), Gaps = 2/35 (5%) Frame = +3 Query: 186 NSQNLKGF--GQPTSLLGLNHLTPSQINQIQAQIQ 284 N+QN+ GF GQPTSLLGLNHLTPSQI+QIQAQIQ Sbjct: 92 NTQNIIGFAQGQPTSLLGLNHLTPSQISQIQAQIQ 126 >XP_017422614.1 PREDICTED: ethylene-responsive transcription factor RAP2-4 [Vigna angularis] KOM41686.1 hypothetical protein LR48_Vigan04g188400 [Vigna angularis] BAT78536.1 hypothetical protein VIGAN_02122500 [Vigna angularis var. angularis] Length = 353 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/35 (82%), Positives = 32/35 (91%), Gaps = 2/35 (5%) Frame = +3 Query: 186 NSQNLKGF--GQPTSLLGLNHLTPSQINQIQAQIQ 284 N+QN+ GF GQPTSLLGLNHLTPSQI+QIQAQIQ Sbjct: 92 NTQNIIGFAHGQPTSLLGLNHLTPSQISQIQAQIQ 126 >XP_019430857.1 PREDICTED: ethylene-responsive transcription factor RAP2-13-like [Lupinus angustifolius] OIW16590.1 hypothetical protein TanjilG_02796 [Lupinus angustifolius] Length = 337 Score = 57.0 bits (136), Expect = 2e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = +3 Query: 186 NSQNLKGFGQPTSLLGLNHLTPSQINQIQAQIQHPNHL 299 NSQN GF QP+S+LG NHLTPS INQIQAQ+Q N + Sbjct: 96 NSQNFTGFEQPSSVLGFNHLTPSPINQIQAQVQTQNKI 133 >XP_004500614.1 PREDICTED: ethylene-responsive transcription factor RAP2-4 [Cicer arietinum] Length = 325 Score = 56.2 bits (134), Expect = 5e-07 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 3/45 (6%) Frame = +3 Query: 189 SQNLKGFGQPTS---LLGLNHLTPSQINQIQAQIQHPNHLTWQHQ 314 +QN GF QP+S +LGLNHLTPSQINQIQ QIQH N Q Q Sbjct: 65 TQNFIGFAQPSSSCSVLGLNHLTPSQINQIQTQIQHQNFTQQQEQ 109 >XP_003526587.1 PREDICTED: ethylene-responsive transcription factor RAP2-4 [Glycine max] KRH53092.1 hypothetical protein GLYMA_06G105000 [Glycine max] Length = 302 Score = 55.8 bits (133), Expect = 6e-07 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 2/37 (5%) Frame = +3 Query: 180 SYNSQNLKGFGQ--PTSLLGLNHLTPSQINQIQAQIQ 284 S N+Q+L GFGQ PTSL+GLNHLTPSQI+QIQAQIQ Sbjct: 56 SSNTQSLIGFGQAQPTSLVGLNHLTPSQISQIQAQIQ 92 >GAU24550.1 hypothetical protein TSUD_148910 [Trifolium subterraneum] Length = 229 Score = 55.1 bits (131), Expect = 8e-07 Identities = 30/47 (63%), Positives = 32/47 (68%), Gaps = 3/47 (6%) Frame = +3 Query: 183 YNSQNLKGFGQPTS---LLGLNHLTPSQINQIQAQIQHPNHLTWQHQ 314 + SQN GF QP+S LLGLNHLTPSQINQIQ QIQ N Q Q Sbjct: 70 FYSQNFIGFTQPSSSSSLLGLNHLTPSQINQIQTQIQQQNFTMQQQQ 116 >AEI16474.1 dehydration-responsive element binding protein [Lespedeza potaninii] Length = 318 Score = 55.5 bits (132), Expect = 8e-07 Identities = 31/40 (77%), Positives = 33/40 (82%), Gaps = 3/40 (7%) Frame = +3 Query: 186 NSQNLKGFGQ--PTS-LLGLNHLTPSQINQIQAQIQHPNH 296 N+QNL GFGQ PTS LLGLNHLTPSQI+QIQAQI NH Sbjct: 70 NTQNLIGFGQVQPTSSLLGLNHLTPSQISQIQAQIHVQNH 109 >ACJ83281.1 unknown, partial [Medicago truncatula] Length = 103 Score = 51.6 bits (122), Expect = 3e-06 Identities = 27/40 (67%), Positives = 28/40 (70%), Gaps = 6/40 (15%) Frame = +3 Query: 183 YNSQNLKGFGQPTS------LLGLNHLTPSQINQIQAQIQ 284 Y QN GF QP+S LLGLNHLTPSQINQIQ QIQ Sbjct: 63 YTEQNFIGFAQPSSSFSSPSLLGLNHLTPSQINQIQVQIQ 102 >XP_019461680.1 PREDICTED: ethylene-responsive transcription factor RAP2-4-like [Lupinus angustifolius] OIW02392.1 hypothetical protein TanjilG_04985 [Lupinus angustifolius] Length = 358 Score = 53.5 bits (127), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 180 SYNSQNLKGFGQPTSLLGLNHLTPSQINQIQAQI 281 S NSQN GF QPTS+LGLN+LT SQINQIQAQI Sbjct: 95 SSNSQNFIGFEQPTSVLGLNNLTTSQINQIQAQI 128