BLASTX nr result
ID: Glycyrrhiza32_contig00006396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00006396 (623 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004515902.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 4e-07 >XP_004515902.1 PREDICTED: pentatricopeptide repeat-containing protein At3g48250, chloroplastic-like [Cicer arietinum] Length = 635 Score = 60.1 bits (144), Expect = 4e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 623 IKEGRLSEAKDLLCKCPSHIRRRKQICDFFAFVENRMAAT 504 I+EG+LSEAKDLL KCPS IRRR+Q+ +FF VENR AA+ Sbjct: 592 IREGKLSEAKDLLSKCPSRIRRRRQVVEFFDSVENRNAAS 631