BLASTX nr result
ID: Glycyrrhiza32_contig00006214
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00006214 (230 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHM99387.1 Seed trypsin/chymotrypsin inhibitor TI5-72 [Glycine s... 55 4e-08 NP_001237767.1 Bowman-Birk type protease inhibitor-like precurso... 55 4e-08 NP_001236539.1 uncharacterized protein LOC100305522 precursor [G... 55 4e-08 XP_017408321.1 PREDICTED: seed trypsin/chymotrypsin inhibitor IV... 55 5e-08 XP_003623933.1 Bowman birk trypsin inhibitor [Medicago truncatul... 52 7e-07 CAC24564.1 trypsin inhibitor [Pisum sativum] 52 7e-07 XP_003623930.2 Bowman birk trypsin inhibitor [Medicago truncatul... 52 8e-07 prf||0401177A inhibitor,trypsin chymotrypsin elastase 51 1e-06 KOM27952.1 hypothetical protein LR48_Vigan470s000500 [Vigna angu... 54 1e-06 NP_001238409.1 Bowman-Birk type proteinase inhibitor C-II [Glyci... 51 1e-06 AAD09815.1 Bowman-Birk proteinase inhibitor, partial [Glycine max] 50 1e-06 AAA19574.1 Bowman-Birk protease inhibitor, partial [Glycine max] 50 1e-06 AAA19613.1 Bowman-Birk protease inhibitor, partial [Glycine max] 50 1e-06 P83284.1 RecName: Full=Bowman-birk type proteinase inhibitor; Al... 50 2e-06 pir||JC2225 Bowman-Birk proteinase isoinhibitor C-II precursor (... 51 2e-06 AAA33952.1 CII protease inhibitor precursor [Glycine max] 51 2e-06 AFK47823.1 unknown [Medicago truncatula] 51 2e-06 BAB86785.1 Bowman-Birk type proteinase isoinhibitor C [Glycine s... 51 2e-06 XP_003544720.1 PREDICTED: Bowman-Birk type proteinase inhibitor ... 51 2e-06 XP_003534064.1 PREDICTED: Bowman-Birk type proteinase inhibitor ... 51 2e-06 >KHM99387.1 Seed trypsin/chymotrypsin inhibitor TI5-72 [Glycine soja] Length = 113 Score = 55.5 bits (132), Expect = 4e-08 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 C C S+PP+C C DIT+FCY+PCNSSE E Sbjct: 82 CICTRSIPPQCHCSDITNFCYEPCNSSETE 111 >NP_001237767.1 Bowman-Birk type protease inhibitor-like precursor [Glycine max] ACA23206.1 putative Bowman-Birk type protease inhibitor [Glycine max] Length = 117 Score = 55.5 bits (132), Expect = 4e-08 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 C C S+PP+C C DIT+FCY+PCNSSE E Sbjct: 86 CICTRSIPPQCHCSDITNFCYEPCNSSETE 115 >NP_001236539.1 uncharacterized protein LOC100305522 precursor [Glycine max] ACU13240.1 unknown [Glycine max] KRH00722.1 hypothetical protein GLYMA_18G231500 [Glycine max] Length = 117 Score = 55.5 bits (132), Expect = 4e-08 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 C C S+PP+C C DIT+FCY+PCNSSE E Sbjct: 86 CICTRSIPPQCHCSDITNFCYEPCNSSETE 115 >XP_017408321.1 PREDICTED: seed trypsin/chymotrypsin inhibitor IVA-like [Vigna angularis] BAT83642.1 hypothetical protein VIGAN_04082600 [Vigna angularis var. angularis] Length = 121 Score = 55.5 bits (132), Expect = 5e-08 Identities = 23/37 (62%), Positives = 27/37 (72%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAEKLTKNDQ 118 C C +S+PP+CRC DITDFCY PC+S E KL N Q Sbjct: 85 CVCTKSIPPQCRCEDITDFCYKPCHSEE-PKLAGNSQ 120 >XP_003623933.1 Bowman birk trypsin inhibitor [Medicago truncatula] AES80151.1 Bowman birk trypsin inhibitor [Medicago truncatula] Length = 86 Score = 51.6 bits (122), Expect = 7e-07 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSS 148 C C ESLP KC C+DIT+FCY+PCN+S Sbjct: 55 CRCFESLPLKCTCLDITEFCYEPCNNS 81 >CAC24564.1 trypsin inhibitor [Pisum sativum] Length = 104 Score = 52.0 bits (123), Expect = 7e-07 Identities = 18/25 (72%), Positives = 21/25 (84%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCN 154 C C SLPP+CRC+DITDFCY+ CN Sbjct: 80 CICTRSLPPQCRCIDITDFCYEKCN 104 >XP_003623930.2 Bowman birk trypsin inhibitor [Medicago truncatula] AES80148.2 Bowman birk trypsin inhibitor [Medicago truncatula] Length = 107 Score = 52.0 bits (123), Expect = 8e-07 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 C C ES P KC C+DITDFCY+PCNS+ A+ Sbjct: 76 CRCFESFPLKCDCLDITDFCYEPCNSTIAK 105 >prf||0401177A inhibitor,trypsin chymotrypsin elastase Length = 76 Score = 50.8 bits (120), Expect = 1e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 CAC S+P +CRC+D TDFCY PC SS+ + Sbjct: 45 CACTRSMPGQCRCLDTTDFCYKPCKSSDED 74 >KOM27952.1 hypothetical protein LR48_Vigan470s000500 [Vigna angularis] Length = 236 Score = 53.5 bits (127), Expect = 1e-06 Identities = 19/28 (67%), Positives = 23/28 (82%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSE 145 C C +S+PP+CRC DITDFCY PC+S E Sbjct: 85 CVCTKSIPPQCRCEDITDFCYKPCHSEE 112 >NP_001238409.1 Bowman-Birk type proteinase inhibitor C-II [Glycine max] P01063.2 RecName: Full=Bowman-Birk type proteinase inhibitor C-II; Flags: Precursor CAA48656.1 Bowman-Birk proteinase isoinhibitor C-II [Glycine max] AAA33953.1 protease inhibitor C-II [Glycine max] CAA54144.1 C-II protease inhibitor [Glycine max] KRH15895.1 hypothetical protein GLYMA_14G117600 [Glycine max] KRH38802.1 hypothetical protein GLYMA_09G158800 [Glycine max] Length = 83 Score = 50.8 bits (120), Expect = 1e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 CAC S+P +CRC+D TDFCY PC SS+ + Sbjct: 52 CACTRSMPGQCRCLDTTDFCYKPCKSSDED 81 >AAD09815.1 Bowman-Birk proteinase inhibitor, partial [Glycine max] Length = 35 Score = 49.7 bits (117), Expect = 1e-06 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAEK 136 C C S P +C CVDITDFCY+PC SE +K Sbjct: 3 CICALSYPAQCFCVDITDFCYEPCKPSEDDK 33 >AAA19574.1 Bowman-Birk protease inhibitor, partial [Glycine max] Length = 41 Score = 49.7 bits (117), Expect = 1e-06 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAEK 136 C C S P +C CVDITDFCY+PC SE +K Sbjct: 8 CICALSYPAQCFCVDITDFCYEPCKPSEDDK 38 >AAA19613.1 Bowman-Birk protease inhibitor, partial [Glycine max] Length = 42 Score = 49.7 bits (117), Expect = 1e-06 Identities = 19/31 (61%), Positives = 22/31 (70%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAEK 136 C C S P +C CVDITDFCY+PC SE +K Sbjct: 10 CICALSYPAQCFCVDITDFCYEPCKPSEDDK 40 >P83284.1 RecName: Full=Bowman-birk type proteinase inhibitor; AltName: Full=TaTI Length = 63 Score = 50.1 bits (118), Expect = 2e-06 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCN 154 CAC S+P KCRC DITDFCY PC+ Sbjct: 38 CACTRSIPAKCRCFDITDFCYKPCS 62 >pir||JC2225 Bowman-Birk proteinase isoinhibitor C-II precursor (clone pB24) - soybean prf||2013215B Bowman-Birk protease inhibitor Length = 94 Score = 50.8 bits (120), Expect = 2e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 CAC S+P +CRC+D TDFCY PC SS+ + Sbjct: 63 CACTRSMPGQCRCLDTTDFCYKPCKSSDED 92 >AAA33952.1 CII protease inhibitor precursor [Glycine max] Length = 103 Score = 50.8 bits (120), Expect = 2e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 CAC S+P +CRC+D TDFCY PC SS+ + Sbjct: 72 CACTRSMPGQCRCLDTTDFCYKPCKSSDED 101 >AFK47823.1 unknown [Medicago truncatula] Length = 107 Score = 50.8 bits (120), Expect = 2e-06 Identities = 20/30 (66%), Positives = 23/30 (76%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 C C ES P KC C DITDFCY+PCNS+ A+ Sbjct: 76 CRCFESFPLKCDCPDITDFCYEPCNSTIAK 105 >BAB86785.1 Bowman-Birk type proteinase isoinhibitor C [Glycine soja] KHM99783.1 Bowman-Birk type proteinase inhibitor C-II [Glycine soja] KHM99784.1 Bowman-Birk type proteinase inhibitor C-II [Glycine soja] KRH38800.1 hypothetical protein GLYMA_09G158600 [Glycine max] Length = 109 Score = 50.8 bits (120), Expect = 2e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 CAC S+P +CRC+D TDFCY PC SS+ + Sbjct: 78 CACTRSMPGQCRCLDTTDFCYKPCKSSDED 107 >XP_003544720.1 PREDICTED: Bowman-Birk type proteinase inhibitor C-II-like [Glycine max] KHN30407.1 Bowman-Birk type proteinase inhibitor C-II [Glycine soja] Length = 109 Score = 50.8 bits (120), Expect = 2e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 CAC S+P +CRC+D TDFCY PC SS+ + Sbjct: 78 CACTRSMPGQCRCLDTTDFCYKPCKSSDED 107 >XP_003534064.1 PREDICTED: Bowman-Birk type proteinase inhibitor C-II-like [Glycine max] KRH38801.1 hypothetical protein GLYMA_09G158700 [Glycine max] Length = 109 Score = 50.8 bits (120), Expect = 2e-06 Identities = 18/30 (60%), Positives = 23/30 (76%) Frame = -3 Query: 228 CACGESLPPKCRCVDITDFCYDPCNSSEAE 139 CAC S+P +CRC+D TDFCY PC SS+ + Sbjct: 78 CACTRSMPGQCRCLDTTDFCYKPCKSSDED 107