BLASTX nr result
ID: Glycyrrhiza32_contig00006207
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00006207 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU36418.1 hypothetical protein TSUD_38860 [Trifolium subterraneum] 67 5e-11 XP_004495882.2 PREDICTED: transcription factor MYB108-like [Cice... 65 4e-10 KOM39377.1 hypothetical protein LR48_Vigan03g275900 [Vigna angul... 57 3e-07 XP_017416802.1 PREDICTED: transcription factor MYB108-like [Vign... 57 3e-07 XP_014495060.1 PREDICTED: transcription factor MYB24-like [Vigna... 57 4e-07 KYP56143.1 Transcription factor MYB21 [Cajanus cajan] 55 9e-07 XP_015939425.1 PREDICTED: transcription factor MYB108-like isofo... 53 7e-06 XP_015939424.1 PREDICTED: transcription factor MYB108-like isofo... 53 7e-06 XP_016177559.1 PREDICTED: transcription factor MYB108-like isofo... 53 9e-06 XP_016177558.1 PREDICTED: transcription factor MYB108-like isofo... 53 9e-06 >GAU36418.1 hypothetical protein TSUD_38860 [Trifolium subterraneum] Length = 274 Score = 67.4 bits (163), Expect = 5e-11 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -1 Query: 345 GGDSLESLWNDESMWFLQQLSDDLEIKYNFLA 250 GGDSLE+LWNDE+MWFLQQLSDDLEIKYN+LA Sbjct: 243 GGDSLENLWNDENMWFLQQLSDDLEIKYNYLA 274 >XP_004495882.2 PREDICTED: transcription factor MYB108-like [Cicer arietinum] Length = 293 Score = 65.1 bits (157), Expect = 4e-10 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 345 GGDSLESLWNDESMWFLQQLSDDLEIKYNFLA 250 GGDSLESLWNDESMWFLQQLSDDL+IKYN A Sbjct: 262 GGDSLESLWNDESMWFLQQLSDDLQIKYNSFA 293 >KOM39377.1 hypothetical protein LR48_Vigan03g275900 [Vigna angularis] Length = 267 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 345 GGDSLESLWNDESMWFLQQLSDDLEIKYNFLA 250 GGDS+ESLW+DE++W +QQL DDLEIK NFLA Sbjct: 236 GGDSMESLWDDENLWLMQQLCDDLEIKDNFLA 267 >XP_017416802.1 PREDICTED: transcription factor MYB108-like [Vigna angularis] BAT86226.1 hypothetical protein VIGAN_04385600 [Vigna angularis var. angularis] Length = 269 Score = 57.0 bits (136), Expect = 3e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 345 GGDSLESLWNDESMWFLQQLSDDLEIKYNFLA 250 GGDS+ESLW+DE++W +QQL DDLEIK NFLA Sbjct: 238 GGDSMESLWDDENLWLMQQLCDDLEIKDNFLA 269 >XP_014495060.1 PREDICTED: transcription factor MYB24-like [Vigna radiata var. radiata] Length = 365 Score = 57.0 bits (136), Expect = 4e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 345 GGDSLESLWNDESMWFLQQLSDDLEIKYNFLA 250 GGDS+ESLW+DE++W +QQL DDLEIK NFLA Sbjct: 237 GGDSMESLWDDENLWLMQQLCDDLEIKDNFLA 268 >KYP56143.1 Transcription factor MYB21 [Cajanus cajan] Length = 241 Score = 55.5 bits (132), Expect = 9e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -1 Query: 345 GGDSLESLWNDESMWFLQQLSDDLEIKYNFL 253 G D+LE+LWND++MWFLQ LSDDL+IKYN L Sbjct: 210 GADTLETLWNDQNMWFLQLLSDDLQIKYNSL 240 >XP_015939425.1 PREDICTED: transcription factor MYB108-like isoform X2 [Arachis duranensis] Length = 262 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/33 (72%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = -1 Query: 345 GGDSLESLWNDESMWFL-QQLSDDLEIKYNFLA 250 GG+SLE LWNDE++WFL QQL DDLE+K+N LA Sbjct: 230 GGESLECLWNDENVWFLQQQLCDDLEVKFNSLA 262 >XP_015939424.1 PREDICTED: transcription factor MYB108-like isoform X1 [Arachis duranensis] Length = 266 Score = 53.1 bits (126), Expect = 7e-06 Identities = 24/33 (72%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = -1 Query: 345 GGDSLESLWNDESMWFL-QQLSDDLEIKYNFLA 250 GG+SLE LWNDE++WFL QQL DDLE+K+N LA Sbjct: 234 GGESLECLWNDENVWFLQQQLCDDLEVKFNSLA 266 >XP_016177559.1 PREDICTED: transcription factor MYB108-like isoform X2 [Arachis ipaensis] Length = 262 Score = 52.8 bits (125), Expect = 9e-06 Identities = 24/33 (72%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = -1 Query: 345 GGDSLESLWNDESMWFL-QQLSDDLEIKYNFLA 250 GG+SLE LWNDE++WFL QQL DDLE+K+N LA Sbjct: 230 GGESLEYLWNDENVWFLQQQLCDDLEVKFNSLA 262 >XP_016177558.1 PREDICTED: transcription factor MYB108-like isoform X1 [Arachis ipaensis] Length = 266 Score = 52.8 bits (125), Expect = 9e-06 Identities = 24/33 (72%), Positives = 29/33 (87%), Gaps = 1/33 (3%) Frame = -1 Query: 345 GGDSLESLWNDESMWFL-QQLSDDLEIKYNFLA 250 GG+SLE LWNDE++WFL QQL DDLE+K+N LA Sbjct: 234 GGESLEYLWNDENVWFLQQQLCDDLEVKFNSLA 266