BLASTX nr result
ID: Glycyrrhiza32_contig00006113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00006113 (232 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_028152394.1 MULTISPECIES: ArdC antirestriction protein [Brady... 54 8e-07 WP_071208317.1 antirestriction protein ArdC [Agrobacterium vitis... 54 2e-06 WP_071204369.1 antirestriction protein ArdC [Agrobacterium vitis... 54 2e-06 WP_012648960.1 antirestriction protein [Agrobacterium vitis] ACM... 54 2e-06 WP_077548973.1 antirestriction protein ArdC [Rhizobium flavum] 53 3e-06 WP_023801726.1 hypothetical protein [Mesorhizobium sp. L48C026A0... 50 3e-06 WP_060716548.1 hypothetical protein [Agrobacterium vitis] KWT952... 49 4e-06 WP_059188849.1 hypothetical protein [Mesorhizobium loti] KUM2442... 50 4e-06 WP_054313313.1 hypothetical protein [Mesorhizobium sp. 1M-11] 50 4e-06 WP_069694177.1 antirestriction protein ArdC [Bosea vaviloviae] A... 52 6e-06 WP_066877911.1 antirestriction protein ArdC [Sinorhizobium sahel... 52 8e-06 >WP_028152394.1 MULTISPECIES: ArdC antirestriction protein [Bradyrhizobium] Length = 306 Score = 54.3 bits (129), Expect = 8e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R FSAAAHAQRAVAYLHSLQP+AE+E+EAA Sbjct: 276 RAIFSAAAHAQRAVAYLHSLQPKAENEQEAA 306 >WP_071208317.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ40520.1 antirestriction protein ArdC [Agrobacterium vitis] Length = 308 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R F AAAHAQRAVAYLH+LQPQA++EREAA Sbjct: 278 RAIFQAAAHAQRAVAYLHALQPQADTEREAA 308 >WP_071204369.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ20675.1 antirestriction protein ArdC [Agrobacterium vitis] Length = 308 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R F AAAHAQRAVAYLH+LQPQA++EREAA Sbjct: 278 RAIFQAAAHAQRAVAYLHALQPQADTEREAA 308 >WP_012648960.1 antirestriction protein [Agrobacterium vitis] ACM39594.1 antirestriction protein (plasmid) [Agrobacterium vitis S4] OHZ16572.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ38549.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ38720.1 antirestriction protein ArdC [Agrobacterium vitis] OHZ43583.1 antirestriction protein ArdC [Agrobacterium vitis] Length = 308 Score = 53.5 bits (127), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R F AAAHAQRAVAYLH+LQPQA++EREAA Sbjct: 278 RAIFQAAAHAQRAVAYLHALQPQADTEREAA 308 >WP_077548973.1 antirestriction protein ArdC [Rhizobium flavum] Length = 308 Score = 52.8 bits (125), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R F AAAHAQRAVAYLH LQP+AE+EREAA Sbjct: 278 RAIFQAAAHAQRAVAYLHDLQPKAETEREAA 308 >WP_023801726.1 hypothetical protein [Mesorhizobium sp. L48C026A00] ESZ13026.1 hypothetical protein X737_26480 [Mesorhizobium sp. L48C026A00] Length = 78 Score = 49.7 bits (117), Expect = 3e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R FSAAAHAQRAVA+LH LQP A EREAA Sbjct: 48 RAIFSAAAHAQRAVAFLHGLQPAASEEREAA 78 >WP_060716548.1 hypothetical protein [Agrobacterium vitis] KWT95279.1 hypothetical protein ASB66_19575 [Agrobacterium vitis] Length = 72 Score = 49.3 bits (116), Expect = 4e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R F+AAAHAQRAVAYLH LQPQA S +EAA Sbjct: 42 RAIFNAAAHAQRAVAYLHDLQPQAASGQEAA 72 >WP_059188849.1 hypothetical protein [Mesorhizobium loti] KUM24429.1 hypothetical protein AU467_30400 [Mesorhizobium loti] Length = 91 Score = 49.7 bits (117), Expect = 4e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R FSAAAHAQRAVA+LH LQP A EREAA Sbjct: 61 RAIFSAAAHAQRAVAFLHGLQPAASEEREAA 91 >WP_054313313.1 hypothetical protein [Mesorhizobium sp. 1M-11] Length = 91 Score = 49.7 bits (117), Expect = 4e-06 Identities = 24/31 (77%), Positives = 25/31 (80%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R FSAAAHAQRAVA+LH LQP A EREAA Sbjct: 61 RAIFSAAAHAQRAVAFLHGLQPAASEEREAA 91 >WP_069694177.1 antirestriction protein ArdC [Bosea vaviloviae] AOO84994.1 antirestriction protein ArdC (plasmid) [Bosea vaviloviae] Length = 308 Score = 52.0 bits (123), Expect = 6e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R F AAAHAQRAVAYLH LQP++E+EREAA Sbjct: 278 RAIFQAAAHAQRAVAYLHGLQPESEAEREAA 308 >WP_066877911.1 antirestriction protein ArdC [Sinorhizobium saheli] OAP39707.1 antirestriction protein ArdC [Sinorhizobium saheli] Length = 308 Score = 51.6 bits (122), Expect = 8e-06 Identities = 25/31 (80%), Positives = 26/31 (83%) Frame = -1 Query: 232 RVTFSAAAHAQRAVAYLHSLQPQAESEREAA 140 R F AAAHAQRAVAYLH LQPQAE+ REAA Sbjct: 278 RAIFQAAAHAQRAVAYLHDLQPQAETGREAA 308