BLASTX nr result
ID: Glycyrrhiza32_contig00005088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00005088 (363 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007153624.1 hypothetical protein PHAVU_003G051200g [Phaseolus... 65 9e-10 AHA84211.1 S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris] 65 9e-10 AQK49909.1 Adenosylhomocysteinase [Zea mays] 63 1e-09 AQK49907.1 Adenosylhomocysteinase [Zea mays] 63 2e-09 OEL36145.1 Adenosylhomocysteinase [Dichanthelium oligosanthes] 63 3e-09 XP_020106819.1 adenosylhomocysteinase [Ananas comosus] OAY69620.... 63 3e-09 XP_016187706.1 PREDICTED: adenosylhomocysteinase-like [Arachis i... 63 3e-09 XP_015958228.1 PREDICTED: adenosylhomocysteinase [Arachis durane... 63 3e-09 XP_010097949.1 hypothetical protein L484_026840 [Morus notabilis... 63 3e-09 CDP15078.1 unnamed protein product [Coffea canephora] 63 3e-09 AGT16642.1 Adenosylhomocysteinase [Saccharum hybrid cultivar R570] 63 3e-09 NP_001148534.2 adenosylhomocysteinase [Zea mays] ACN34730.1 unkn... 63 3e-09 ACG31873.1 adenosylhomocysteinase [Zea mays] 63 3e-09 XP_006662925.1 PREDICTED: adenosylhomocysteinase [Oryza brachyan... 63 3e-09 XP_004973012.1 PREDICTED: adenosylhomocysteinase-like [Setaria i... 63 3e-09 XP_004953493.1 PREDICTED: adenosylhomocysteinase [Setaria italic... 63 3e-09 AAO72664.1 wheat adenosylhomocysteinase-like protein [Oryza sati... 63 3e-09 XP_003577583.2 PREDICTED: adenosylhomocysteinase [Brachypodium d... 62 6e-09 CAJ01707.1 putative S-adenosylhomocystein hydrolase 2 [Hordeum v... 62 6e-09 XP_009415939.1 PREDICTED: adenosylhomocysteinase [Musa acuminata... 62 6e-09 >XP_007153624.1 hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris] ESW25618.1 hypothetical protein PHAVU_003G051200g [Phaseolus vulgaris] Length = 485 Score = 64.7 bits (156), Expect = 9e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 MSLSVEKT+TGREYKVKDLSQADFGRLEIELAE Sbjct: 1 MSLSVEKTTTGREYKVKDLSQADFGRLEIELAE 33 >AHA84211.1 S-adenosyl-L-homocysteine hydrolase [Phaseolus vulgaris] Length = 485 Score = 64.7 bits (156), Expect = 9e-10 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 MSLSVEKT+TGREYKVKDLSQADFGRLEIELAE Sbjct: 1 MSLSVEKTTTGREYKVKDLSQADFGRLEIELAE 33 >AQK49909.1 Adenosylhomocysteinase [Zea mays] Length = 237 Score = 63.2 bits (152), Expect = 1e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >AQK49907.1 Adenosylhomocysteinase [Zea mays] Length = 242 Score = 63.2 bits (152), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >OEL36145.1 Adenosylhomocysteinase [Dichanthelium oligosanthes] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >XP_020106819.1 adenosylhomocysteinase [Ananas comosus] OAY69620.1 Adenosylhomocysteinase [Ananas comosus] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >XP_016187706.1 PREDICTED: adenosylhomocysteinase-like [Arachis ipaensis] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 MSLSVEKT++GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MSLSVEKTTSGREYKVKDLSQADFGRLEIELAE 33 >XP_015958228.1 PREDICTED: adenosylhomocysteinase [Arachis duranensis] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 MSLSVEKT++GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MSLSVEKTTSGREYKVKDLSQADFGRLEIELAE 33 >XP_010097949.1 hypothetical protein L484_026840 [Morus notabilis] EXB73679.1 hypothetical protein L484_026840 [Morus notabilis] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >CDP15078.1 unnamed protein product [Coffea canephora] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >AGT16642.1 Adenosylhomocysteinase [Saccharum hybrid cultivar R570] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >NP_001148534.2 adenosylhomocysteinase [Zea mays] ACN34730.1 unknown [Zea mays] AQK49910.1 Adenosylhomocysteinase [Zea mays] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >ACG31873.1 adenosylhomocysteinase [Zea mays] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >XP_006662925.1 PREDICTED: adenosylhomocysteinase [Oryza brachyantha] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >XP_004973012.1 PREDICTED: adenosylhomocysteinase-like [Setaria italica] KQL01047.1 hypothetical protein SETIT_013650mg [Setaria italica] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >XP_004953493.1 PREDICTED: adenosylhomocysteinase [Setaria italica] KQL30999.1 hypothetical protein SETIT_017049mg [Setaria italica] KQL31000.1 hypothetical protein SETIT_017049mg [Setaria italica] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >AAO72664.1 wheat adenosylhomocysteinase-like protein [Oryza sativa Japonica Group] EAY80818.1 hypothetical protein OsI_35998 [Oryza sativa Indica Group] EEE52055.1 hypothetical protein OsJ_33804 [Oryza sativa Japonica Group] AIR95993.1 adenosylhomocysteinase [Oryza sativa Japonica Group] Length = 485 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLEIELAE 33 >XP_003577583.2 PREDICTED: adenosylhomocysteinase [Brachypodium distachyon] KQJ88547.1 hypothetical protein BRADI_4g19457 [Brachypodium distachyon] Length = 485 Score = 62.4 bits (150), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLE+ELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLELELAE 33 >CAJ01707.1 putative S-adenosylhomocystein hydrolase 2 [Hordeum vulgare subsp. vulgare] BAJ88218.1 predicted protein [Hordeum vulgare subsp. vulgare] Length = 485 Score = 62.4 bits (150), Expect = 6e-09 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+LSVEKTS+GREYKVKDLSQADFGRLE+ELAE Sbjct: 1 MALSVEKTSSGREYKVKDLSQADFGRLELELAE 33 >XP_009415939.1 PREDICTED: adenosylhomocysteinase [Musa acuminata subsp. malaccensis] Length = 485 Score = 62.4 bits (150), Expect = 6e-09 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +3 Query: 264 MSLSVEKTSTGREYKVKDLSQADFGRLEIELAE 362 M+L VEKTSTGREYKVKDLSQADFGRLEIELAE Sbjct: 1 MALLVEKTSTGREYKVKDLSQADFGRLEIELAE 33