BLASTX nr result
ID: Glycyrrhiza32_contig00005014
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00005014 (472 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003596726.1 hypothetical protein MTR_2g084160 [Medicago trunc... 59 7e-09 XP_013464826.1 hypothetical protein MTR_2g084200 [Medicago trunc... 59 8e-09 XP_003596728.1 hypothetical protein MTR_2g084180 [Medicago trunc... 59 8e-09 AFK34944.1 unknown [Medicago truncatula] 57 2e-08 XP_003596729.1 hypothetical protein MTR_2g084190 [Medicago trunc... 55 1e-07 XP_013464825.1 hypothetical protein MTR_2g084195 [Medicago trunc... 55 2e-07 XP_003596727.1 hypothetical protein MTR_2g084170 [Medicago trunc... 55 2e-07 ACU15891.1 unknown [Glycine max] 52 3e-06 KRH54856.1 hypothetical protein GLYMA_06G214400 [Glycine max] 52 3e-06 KHN44123.1 hypothetical protein glysoja_048642 [Glycine soja] 52 3e-06 XP_013464829.1 hypothetical protein MTR_2g084215 [Medicago trunc... 52 4e-06 KRH54853.1 hypothetical protein GLYMA_06G214100 [Glycine max] 51 6e-06 >XP_003596726.1 hypothetical protein MTR_2g084160 [Medicago truncatula] AES66977.1 hypothetical protein MTR_2g084160 [Medicago truncatula] Length = 70 Score = 58.9 bits (141), Expect = 7e-09 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCH--NGNIGDSALVAYREGDVDDDTGYDYAPA 327 PKC G+ +GD FGYAST I+G+ + N + G + L+AY EGD DDD GYDYAPA Sbjct: 11 PKCNHAAYGECDGDWFGYASTIC-IKGNYYFRNEDSGSAHLIAYIEGDDDDDGGYDYAPA 69 Query: 328 S 330 + Sbjct: 70 A 70 >XP_013464826.1 hypothetical protein MTR_2g084200 [Medicago truncatula] KEH38861.1 hypothetical protein MTR_2g084200 [Medicago truncatula] Length = 62 Score = 58.5 bits (140), Expect = 8e-09 Identities = 31/59 (52%), Positives = 37/59 (62%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 PKCK+H +GNGD FGY + IE D NG+ +Y EGD DDD GYDYAPA+ Sbjct: 10 PKCKEHGYDEGNGDWFGYTYVSC-IEEDYRNGDRD-----SYMEGDDDDDGGYDYAPAA 62 >XP_003596728.1 hypothetical protein MTR_2g084180 [Medicago truncatula] AES66979.1 hypothetical protein MTR_2g084180 [Medicago truncatula] Length = 62 Score = 58.5 bits (140), Expect = 8e-09 Identities = 30/59 (50%), Positives = 39/59 (66%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 P CK++ G+GNGD FGY S + +E D NG+ +Y+EGD DDD GYDYAPA+ Sbjct: 10 PLCKQNACGEGNGDWFGYTSVSCIVE-DYRNGDQD-----SYKEGDDDDDGGYDYAPAA 62 >AFK34944.1 unknown [Medicago truncatula] Length = 63 Score = 57.4 bits (137), Expect = 2e-08 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 1/60 (1%) Frame = +1 Query: 154 PKCKKHE-NGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 PKCK++ NG+G+GD FGY + IE D NG+ YREGD DDD GYDYAPA+ Sbjct: 10 PKCKQYAYNGEGDGDWFGYTCVSC-IEEDYTNGDRN-----LYREGDDDDDGGYDYAPAA 63 >XP_003596729.1 hypothetical protein MTR_2g084190 [Medicago truncatula] AES66980.1 hypothetical protein MTR_2g084190 [Medicago truncatula] Length = 62 Score = 55.5 bits (132), Expect = 1e-07 Identities = 31/59 (52%), Positives = 37/59 (62%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 PKCK H +GNGD FGY S + I+ D NG+ DS +EGD DDD GYDYAP + Sbjct: 10 PKCKHHGYSEGNGDWFGYTSVSC-IKEDNRNGD-RDSC----KEGDDDDDGGYDYAPTA 62 >XP_013464825.1 hypothetical protein MTR_2g084195 [Medicago truncatula] KEH38860.1 hypothetical protein MTR_2g084195 [Medicago truncatula] Length = 70 Score = 55.5 bits (132), Expect = 2e-07 Identities = 31/61 (50%), Positives = 39/61 (63%), Gaps = 2/61 (3%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCH--NGNIGDSALVAYREGDVDDDTGYDYAPA 327 PKC G+ + D FGYAST I+G+ + N + G + LV Y EGD DDD GYDYAPA Sbjct: 11 PKCNHAAYGECDVDSFGYASTVC-IKGNYYIRNEDSGSADLVTYMEGDDDDDGGYDYAPA 69 Query: 328 S 330 + Sbjct: 70 A 70 >XP_003596727.1 hypothetical protein MTR_2g084170 [Medicago truncatula] AES66978.1 hypothetical protein MTR_2g084170 [Medicago truncatula] Length = 62 Score = 55.1 bits (131), Expect = 2e-07 Identities = 30/59 (50%), Positives = 38/59 (64%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 PKC++H G+GNGD Y + IE + HNG+ DS +EGD DDD GYDYAPA+ Sbjct: 10 PKCEQHGYGEGNGDWISYTCVSC-IEENYHNGD-RDSC----KEGDDDDDGGYDYAPAA 62 >ACU15891.1 unknown [Glycine max] Length = 58 Score = 52.0 bits (123), Expect = 3e-06 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 P+ KKH +G + Y TA EGD +NGNI + + AY EGD DDD GYDYAPA+ Sbjct: 3 PEIKKHACDKKDGVLYHYDPTACA-EGDDYNGNI--NYVFAYMEGDDDDDGGYDYAPAA 58 >KRH54856.1 hypothetical protein GLYMA_06G214400 [Glycine max] Length = 62 Score = 52.0 bits (123), Expect = 3e-06 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 P+ KKH +G + Y TA EGD +NGNI + + AY EGD DDD GYDYAPA+ Sbjct: 7 PEIKKHACDKKDGVLYHYDPTACA-EGDDYNGNI--NYVFAYMEGDDDDDGGYDYAPAA 62 >KHN44123.1 hypothetical protein glysoja_048642 [Glycine soja] Length = 65 Score = 52.0 bits (123), Expect = 3e-06 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = +1 Query: 154 PKCKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 P+ KKH +G + Y TA EGD +NGNI + + AY EGD DDD GYDYAPA+ Sbjct: 10 PEIKKHACDKKDGVSYHYDPTACA-EGDDYNGNI--NYVFAYMEGDDDDDGGYDYAPAA 65 >XP_013464829.1 hypothetical protein MTR_2g084215 [Medicago truncatula] KEH38864.1 hypothetical protein MTR_2g084215 [Medicago truncatula] Length = 60 Score = 51.6 bits (122), Expect = 4e-06 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +1 Query: 160 CKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSALVAYREGDVDDDTGYDYAPAS 330 CK+H G+GN F Y S + IE D HNG+ +Y+EGD DDD GYDYAPA+ Sbjct: 12 CKQHAYGEGNW--FDYTSVSC-IEEDYHNGDRD-----SYQEGDDDDDGGYDYAPAA 60 >KRH54853.1 hypothetical protein GLYMA_06G214100 [Glycine max] Length = 68 Score = 51.2 bits (121), Expect = 6e-06 Identities = 29/60 (48%), Positives = 37/60 (61%), Gaps = 2/60 (3%) Frame = +1 Query: 157 KCKKHENGDGNGD*FGYASTATRIEGDCHNGNIGDSAL--VAYREGDVDDDTGYDYAPAS 330 +CKKH G+ +GD + Y + EGD H GN GDS +AY +GD D D YDYAPA+ Sbjct: 11 ECKKHACGNKDGDWYLYYAPTACTEGDDHKGN-GDSCFGHIAYMKGDDDSDI-YDYAPAA 68