BLASTX nr result
ID: Glycyrrhiza32_contig00002798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00002798 (269 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume... 101 1e-26 XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus caro... 101 1e-26 XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus pe... 102 2e-26 XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe... 100 2e-26 NP_187239.1 Low temperature and salt responsive protein family [... 99 7e-26 ADK27677.1 plasma membrane protein 3-2 [Salvia miltiorrhiza] 99 7e-26 XP_003626135.2 low temperature and salt responsive family protei... 99 7e-26 XP_019093489.1 PREDICTED: hydrophobic protein RCI2A [Camelina sa... 99 1e-25 XP_004302327.1 PREDICTED: hydrophobic protein RCI2A [Fragaria ve... 99 1e-25 XP_013622833.1 PREDICTED: hydrophobic protein RCI2A [Brassica ol... 99 1e-25 XP_006408015.1 hypothetical protein EUTSA_v10021802mg [Eutrema s... 100 2e-25 XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus ... 98 2e-25 AFI47457.1 low temperature and salt responsive protein [Medicago... 98 2e-25 XP_018488823.1 PREDICTED: hydrophobic protein RCI2A [Raphanus sa... 98 3e-25 XP_009123629.1 PREDICTED: hydrophobic protein RCI2A [Brassica ra... 98 3e-25 XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domes... 98 3e-25 XP_004494505.1 PREDICTED: hydrophobic protein LTI6B [Cicer ariet... 98 3e-25 XP_003626131.1 low temperature and salt responsive family protei... 97 4e-25 XP_003626132.1 low temperature and salt responsive family protei... 97 4e-25 XP_006408016.1 hypothetical protein EUTSA_v10021895mg [Eutrema s... 97 4e-25 >XP_008246327.1 PREDICTED: hydrophobic protein RCI2B [Prunus mume] ONI04114.1 hypothetical protein PRUPE_6G303600 [Prunus persica] Length = 54 Score = 101 bits (251), Expect = 1e-26 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 MGTATFVDII+AILLPPLGVFLKFGC EFWICL+LTL GYLPGIIYAIYI Sbjct: 1 MGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYI 51 >XP_017244642.1 PREDICTED: hydrophobic protein RCI2A [Daucus carota subsp. sativus] KZM96817.1 hypothetical protein DCAR_015821 [Daucus carota subsp. sativus] Length = 56 Score = 101 bits (251), Expect = 1e-26 Identities = 44/52 (84%), Positives = 50/52 (96%) Frame = -1 Query: 158 KMGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 K GTATF+DII+AI+LPPLGVFLKFGCHVEFWICL+LT LGY+PGIIYAIY+ Sbjct: 2 KEGTATFIDIILAIILPPLGVFLKFGCHVEFWICLLLTFLGYIPGIIYAIYV 53 >XP_007206183.1 hypothetical protein PRUPE_ppa013857mg [Prunus persica] Length = 93 Score = 102 bits (253), Expect = 2e-26 Identities = 46/52 (88%), Positives = 49/52 (94%) Frame = -1 Query: 158 KMGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 +MGTATFVDII+AILLPPLGVFLKFGC EFWICL+LTL GYLPGIIYAIYI Sbjct: 39 RMGTATFVDIIIAILLPPLGVFLKFGCEAEFWICLILTLFGYLPGIIYAIYI 90 >XP_012859017.1 PREDICTED: hydrophobic protein RCI2B [Erythranthe guttata] EYU19377.1 hypothetical protein MIMGU_mgv1a0175922mg [Erythranthe guttata] Length = 54 Score = 100 bits (249), Expect = 2e-26 Identities = 47/50 (94%), Positives = 48/50 (96%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 6 MG+ATFVDIIVAILLPPLGVFLKFGC VEFWICLVLTL GYLPGIIYAIY Sbjct: 1 MGSATFVDIIVAILLPPLGVFLKFGCEVEFWICLVLTLFGYLPGIIYAIY 50 >NP_187239.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] Q9ZNQ7.1 RecName: Full=Hydrophobic protein RCI2A; AltName: Full=Low temperature and salt-responsive protein LTI6A AAF26090.1 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] AAK50619.1 hydrophobic protein RCI2A [Arabidopsis thaliana] AAC97512.1 low temperature and salt responsive protein LTI6A [Arabidopsis thaliana] AAD17302.1 hydrophobic protein [Arabidopsis thaliana] AAK59845.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AAK63963.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AAL76128.1 AT3g05880/F10A16_18 [Arabidopsis thaliana] AEE74311.1 Low temperature and salt responsive protein family [Arabidopsis thaliana] OAP02097.1 RCI2A [Arabidopsis thaliana] Length = 54 Score = 99.4 bits (246), Expect = 7e-26 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 M TATFVDII+AILLPPLGVFL+FGC VEFWICLVLTLLGY+PGIIYAIY+ Sbjct: 1 MSTATFVDIIIAILLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYV 51 >ADK27677.1 plasma membrane protein 3-2 [Salvia miltiorrhiza] Length = 54 Score = 99.4 bits (246), Expect = 7e-26 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 MGTATF+DII+AILLPPLGVFLKFGC EFWICL+LTL GY+PGIIYAIYI Sbjct: 1 MGTATFIDIIIAILLPPLGVFLKFGCGAEFWICLILTLFGYIPGIIYAIYI 51 >XP_003626135.2 low temperature and salt responsive family protein [Medicago truncatula] ABD33207.2 Protein of unknown function UPF0057 [Medicago truncatula] AES82353.2 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 99.4 bits (246), Expect = 7e-26 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 6 MGTAT +DIIVAI+LPPLGVFLKFGCHVEFW+CLVLTL GYLPGI+YAIY Sbjct: 1 MGTATCIDIIVAIILPPLGVFLKFGCHVEFWLCLVLTLFGYLPGILYAIY 50 >XP_019093489.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019093498.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019091986.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] XP_019091987.1 PREDICTED: hydrophobic protein RCI2A [Camelina sativa] AFK81273.1 rare cold-inducible protein 2A [Camelina sativa] AFK81275.1 rare cold-inducible protein 2A [Camelina sativa] Length = 54 Score = 99.0 bits (245), Expect = 1e-25 Identities = 44/51 (86%), Positives = 49/51 (96%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 M TATFVDII+A+LLPPLGVFL+FGC VEFWICLVLTLLGY+PGIIYAIY+ Sbjct: 1 MSTATFVDIIIAVLLPPLGVFLRFGCGVEFWICLVLTLLGYIPGIIYAIYV 51 >XP_004302327.1 PREDICTED: hydrophobic protein RCI2A [Fragaria vesca subsp. vesca] Length = 57 Score = 99.0 bits (245), Expect = 1e-25 Identities = 42/50 (84%), Positives = 48/50 (96%) Frame = -1 Query: 152 GTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 GTA F+DII+AILLPPLGVFLKFGCHVEFWICL+LT+ GY+PGIIYAIY+ Sbjct: 5 GTANFIDIIIAILLPPLGVFLKFGCHVEFWICLLLTIFGYIPGIIYAIYV 54 >XP_013622833.1 PREDICTED: hydrophobic protein RCI2A [Brassica oleracea var. oleracea] XP_013622834.1 PREDICTED: hydrophobic protein RCI2A [Brassica oleracea var. oleracea] XP_013684481.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] XP_013684482.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] XP_013684483.1 PREDICTED: hydrophobic protein RCI2A [Brassica napus] CDY49984.1 BnaC03g34410D [Brassica napus] Length = 54 Score = 98.6 bits (244), Expect = 1e-25 Identities = 43/51 (84%), Positives = 50/51 (98%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 MGTATF+DI++AILLPPLGVFL++GC VEFWICLVLTLLGYLPGIIYA+Y+ Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGIIYALYV 51 >XP_006408015.1 hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] ESQ49468.1 hypothetical protein EUTSA_v10021802mg [Eutrema salsugineum] Length = 111 Score = 100 bits (248), Expect = 2e-25 Identities = 44/51 (86%), Positives = 50/51 (98%) Frame = -1 Query: 158 KMGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 6 KMGTATFV+II+AI+LPPLGVFLKFGC +EFWICL+LTLLGYLPGIIYA+Y Sbjct: 56 KMGTATFVEIILAIILPPLGVFLKFGCKIEFWICLILTLLGYLPGIIYALY 106 >XP_009366018.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505092.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] XP_018505094.1 PREDICTED: hydrophobic protein RCI2A-like [Pyrus x bretschneideri] Length = 54 Score = 98.2 bits (243), Expect = 2e-25 Identities = 45/50 (90%), Positives = 47/50 (94%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 6 MGTAT VDII+AILLPPLGVFL+FGCH EFWICLVLTL GYLPGIIYAIY Sbjct: 1 MGTATCVDIIIAILLPPLGVFLRFGCHSEFWICLVLTLFGYLPGIIYAIY 50 >AFI47457.1 low temperature and salt responsive protein [Medicago sativa] Length = 54 Score = 98.2 bits (243), Expect = 2e-25 Identities = 43/51 (84%), Positives = 50/51 (98%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 MGTAT VDII+AI+LPPLGVFLKFGC+VEFWICL+LT+LGYLPGI+YAIY+ Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGILYAIYV 51 >XP_018488823.1 PREDICTED: hydrophobic protein RCI2A [Raphanus sativus] XP_018463797.1 PREDICTED: hydrophobic protein RCI2A [Raphanus sativus] Length = 54 Score = 97.8 bits (242), Expect = 3e-25 Identities = 42/51 (82%), Positives = 50/51 (98%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 MGTATF+DI++AILLPPLGVFL++GC VEFWICLVLTLLGY+PGIIYA+Y+ Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYIPGIIYALYV 51 >XP_009123629.1 PREDICTED: hydrophobic protein RCI2A [Brassica rapa] XP_013638433.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica oleracea var. oleracea] XP_013692999.1 PREDICTED: hydrophobic protein RCI2A-like [Brassica napus] XP_018493382.1 PREDICTED: hydrophobic protein RCI2A-like [Raphanus sativus] XP_018493383.1 PREDICTED: hydrophobic protein RCI2A-like [Raphanus sativus] CDY05209.1 BnaC05g45940D [Brassica napus] Length = 54 Score = 97.8 bits (242), Expect = 3e-25 Identities = 42/51 (82%), Positives = 50/51 (98%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 MGTATF+DI++AILLPPLGVFL++GC VEFWICLVLTLLGYLPGI+YA+Y+ Sbjct: 1 MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGILYALYV 51 >XP_008370335.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] XP_008345581.1 PREDICTED: hydrophobic protein RCI2A [Malus domestica] Length = 54 Score = 97.8 bits (242), Expect = 3e-25 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 6 MGTAT +DII+AILLPPLGVFL+FGCH EFWICLVLTL GYLPGIIYAIY Sbjct: 1 MGTATCIDIIIAILLPPLGVFLRFGCHSEFWICLVLTLFGYLPGIIYAIY 50 >XP_004494505.1 PREDICTED: hydrophobic protein LTI6B [Cicer arietinum] Length = 54 Score = 97.8 bits (242), Expect = 3e-25 Identities = 44/50 (88%), Positives = 49/50 (98%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 6 MGTAT VDII+AI+LPPLGVFLKFGC+VEFWICL+LT+LGYLPGIIYAIY Sbjct: 1 MGTATCVDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIY 50 >XP_003626131.1 low temperature and salt responsive family protein [Medicago truncatula] ABD33189.1 Protein of unknown function UPF0057; Bacterial extracellular solute-binding protein, family 3 [Medicago truncatula] AES82349.1 low temperature and salt responsive family protein [Medicago truncatula] Length = 54 Score = 97.4 bits (241), Expect = 4e-25 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 MGTATFVDII++ILLPPLGVFLKFG VEFWICLVLTL GYLPGIIYAIYI Sbjct: 1 MGTATFVDIILSILLPPLGVFLKFGLEVEFWICLVLTLFGYLPGIIYAIYI 51 >XP_003626132.1 low temperature and salt responsive family protein [Medicago truncatula] ABD33197.1 Protein of unknown function UPF0057 [Medicago truncatula] AES82350.1 low temperature and salt responsive family protein [Medicago truncatula] AFK36815.1 unknown [Medicago truncatula] Length = 54 Score = 97.4 bits (241), Expect = 4e-25 Identities = 43/50 (86%), Positives = 49/50 (98%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIY 6 MGTAT +DII+AI+LPPLGVFLKFGC+VEFWICL+LT+LGYLPGIIYAIY Sbjct: 1 MGTATCIDIILAIILPPLGVFLKFGCNVEFWICLILTILGYLPGIIYAIY 50 >XP_006408016.1 hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] ESQ49469.1 hypothetical protein EUTSA_v10021895mg [Eutrema salsugineum] Length = 54 Score = 97.4 bits (241), Expect = 4e-25 Identities = 42/51 (82%), Positives = 49/51 (96%) Frame = -1 Query: 155 MGTATFVDIIVAILLPPLGVFLKFGCHVEFWICLVLTLLGYLPGIIYAIYI 3 MGTATF+DI++AILLPPLGVFL+FGC VEFWICLVLTL GYLPGI+YA+Y+ Sbjct: 1 MGTATFIDILLAILLPPLGVFLRFGCGVEFWICLVLTLFGYLPGILYALYV 51