BLASTX nr result
ID: Glycyrrhiza32_contig00002597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00002597 (346 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value prf||2022306A salt-inducible protein RF2 65 5e-12 GAU39152.1 hypothetical protein TSUD_147740 [Trifolium subterran... 67 8e-11 CAA75594.1 MtN4, partial [Medicago truncatula] 65 2e-10 XP_003601475.1 Lipid transfer protein [Medicago truncatula] AES7... 65 3e-10 AAD03487.1 proline-rich cell wall protein [Medicago sativa] 65 5e-10 ABK95045.1 unknown [Populus trichocarpa] 63 5e-10 XP_006380877.1 hypothetical protein POPTR_0006s01020g [Populus t... 63 6e-10 XP_011002408.1 PREDICTED: 36.4 kDa proline-rich protein isoform ... 62 9e-10 JAU09762.1 36.4 kDa proline-rich protein, partial [Noccaea caeru... 61 9e-10 CAA47812.1 ptxA [Pisum sativum] 64 9e-10 XP_011002404.1 PREDICTED: 36.4 kDa proline-rich protein isoform ... 62 1e-09 ABR13301.1 putative proline-rich cell wall protein, partial [Pru... 61 1e-09 JAU55343.1 36.4 kDa proline-rich protein, partial [Noccaea caeru... 61 1e-09 AAD53123.1 proline rich protein 1, partial [Vitis vinifera] 59 1e-09 OMO97050.1 hypothetical protein CCACVL1_04687 [Corchorus capsula... 63 2e-09 OMO89007.1 hypothetical protein COLO4_19993 [Corchorus olitorius] 63 2e-09 XP_004304516.1 PREDICTED: 36.4 kDa proline-rich protein [Fragari... 63 2e-09 XP_018830773.1 PREDICTED: 36.4 kDa proline-rich protein-like [Ju... 62 2e-09 BAJ34557.1 unnamed protein product [Eutrema halophilum] 63 2e-09 XP_010510955.1 PREDICTED: 36.4 kDa proline-rich protein-like [Ca... 63 2e-09 >prf||2022306A salt-inducible protein RF2 Length = 50 Score = 65.1 bits (157), Expect = 5e-12 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 LKLLNIN+V+P+ALQ+L+DCGKTPPEGFKCPA Sbjct: 18 LKLLNINLVIPLALQVLIDCGKTPPEGFKCPA 49 >GAU39152.1 hypothetical protein TSUD_147740 [Trifolium subterraneum] Length = 389 Score = 67.4 bits (163), Expect = 8e-11 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCPAT 246 LKLLNINIVLPIALQLL+DCGKTPPEGFKCP++ Sbjct: 357 LKLLNINIVLPIALQLLVDCGKTPPEGFKCPSS 389 >CAA75594.1 MtN4, partial [Medicago truncatula] Length = 249 Score = 65.5 bits (158), Expect = 2e-10 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCPAT 246 LKLLNIN+V+P+ALQ+L+DCGKTPPEGFKCPA+ Sbjct: 217 LKLLNINLVIPLALQVLIDCGKTPPEGFKCPAS 249 >XP_003601475.1 Lipid transfer protein [Medicago truncatula] AES71726.1 Lipid transfer protein [Medicago truncatula] Length = 338 Score = 65.5 bits (158), Expect = 3e-10 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCPAT 246 LKLLNIN+V+P+ALQ+L+DCGKTPPEGFKCPA+ Sbjct: 306 LKLLNINLVIPLALQVLIDCGKTPPEGFKCPAS 338 >AAD03487.1 proline-rich cell wall protein [Medicago sativa] Length = 381 Score = 65.1 bits (157), Expect = 5e-10 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 LKLLNIN+V+P+ALQ+L+DCGKTPPEGFKCPA Sbjct: 349 LKLLNINLVIPLALQVLIDCGKTPPEGFKCPA 380 >ABK95045.1 unknown [Populus trichocarpa] Length = 179 Score = 63.2 bits (152), Expect = 5e-10 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNIN++LPIAL+LL+DCGKTPPEGFKCP+ Sbjct: 149 KLLNINLILPIALELLVDCGKTPPEGFKCPS 179 >XP_006380877.1 hypothetical protein POPTR_0006s01020g [Populus trichocarpa] ERP58674.1 hypothetical protein POPTR_0006s01020g [Populus trichocarpa] Length = 184 Score = 63.2 bits (152), Expect = 6e-10 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNIN++LPIAL+LL+DCGKTPPEGFKCP+ Sbjct: 154 KLLNINLILPIALELLVDCGKTPPEGFKCPS 184 >XP_011002408.1 PREDICTED: 36.4 kDa proline-rich protein isoform X4 [Populus euphratica] Length = 167 Score = 62.4 bits (150), Expect = 9e-10 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNIN+++PIAL+LL+DCGKTPPEGFKCP+ Sbjct: 137 KLLNINLIIPIALELLVDCGKTPPEGFKCPS 167 >JAU09762.1 36.4 kDa proline-rich protein, partial [Noccaea caerulescens] Length = 119 Score = 61.2 bits (147), Expect = 9e-10 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNI+I+LPIAL++LLDCGKTPP GFKCPA Sbjct: 89 KLLNIDIILPIALEVLLDCGKTPPSGFKCPA 119 >CAA47812.1 ptxA [Pisum sativum] Length = 352 Score = 64.3 bits (155), Expect = 9e-10 Identities = 26/33 (78%), Positives = 33/33 (100%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCPAT 246 LKLLNIN+V+P+ALQ+L+DCGKTPPEGFKCP++ Sbjct: 320 LKLLNINLVIPLALQVLIDCGKTPPEGFKCPSS 352 >XP_011002404.1 PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Populus euphratica] XP_011002405.1 PREDICTED: 36.4 kDa proline-rich protein isoform X2 [Populus euphratica] Length = 182 Score = 62.4 bits (150), Expect = 1e-09 Identities = 25/31 (80%), Positives = 31/31 (100%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNIN+++PIAL+LL+DCGKTPPEGFKCP+ Sbjct: 152 KLLNINLIIPIALELLVDCGKTPPEGFKCPS 182 >ABR13301.1 putative proline-rich cell wall protein, partial [Prunus dulcis] Length = 130 Score = 61.2 bits (147), Expect = 1e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNINI++PIALQ+L+DCGKTPP GF+CPA Sbjct: 100 KLLNINIIIPIALQVLIDCGKTPPSGFQCPA 130 >JAU55343.1 36.4 kDa proline-rich protein, partial [Noccaea caerulescens] Length = 137 Score = 61.2 bits (147), Expect = 1e-09 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNI+I+LPIAL++LLDCGKTPP GFKCPA Sbjct: 107 KLLNIDIILPIALEVLLDCGKTPPSGFKCPA 137 >AAD53123.1 proline rich protein 1, partial [Vitis vinifera] Length = 31 Score = 58.5 bits (140), Expect = 1e-09 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLN+NI+LPIALQ+L+ CGKTPP GF+CPA Sbjct: 1 KLLNVNIILPIALQVLVGCGKTPPSGFQCPA 31 >OMO97050.1 hypothetical protein CCACVL1_04687 [Corchorus capsularis] Length = 295 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCP 252 LKLLNINIVLPIALQ+LLDCGKTPP GF+CP Sbjct: 262 LKLLNINIVLPIALQVLLDCGKTPPSGFQCP 292 >OMO89007.1 hypothetical protein COLO4_19993 [Corchorus olitorius] Length = 296 Score = 63.2 bits (152), Expect = 2e-09 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCP 252 LKLLNINIVLPIALQ+LLDCGKTPP GF+CP Sbjct: 263 LKLLNINIVLPIALQVLLDCGKTPPSGFQCP 293 >XP_004304516.1 PREDICTED: 36.4 kDa proline-rich protein [Fragaria vesca subsp. vesca] Length = 315 Score = 63.2 bits (152), Expect = 2e-09 Identities = 25/32 (78%), Positives = 32/32 (100%) Frame = -3 Query: 344 LKLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 LKLLNINI++P+ALQ+L+DCGKTPP+GFKCP+ Sbjct: 284 LKLLNINIIIPLALQVLIDCGKTPPDGFKCPS 315 >XP_018830773.1 PREDICTED: 36.4 kDa proline-rich protein-like [Juglans regia] Length = 234 Score = 62.4 bits (150), Expect = 2e-09 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLN+NI++PIALQLL+DCGKTPP GFKCPA Sbjct: 204 KLLNLNIIIPIALQLLVDCGKTPPPGFKCPA 234 >BAJ34557.1 unnamed protein product [Eutrema halophilum] Length = 335 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNIN++LPIAL+LLLDCGKTPP GFKCPA Sbjct: 305 KLLNINLILPIALELLLDCGKTPPPGFKCPA 335 >XP_010510955.1 PREDICTED: 36.4 kDa proline-rich protein-like [Camelina sativa] Length = 358 Score = 63.2 bits (152), Expect = 2e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 341 KLLNINIVLPIALQLLLDCGKTPPEGFKCPA 249 KLLNIN++LPIAL+LLLDCGKTPP GFKCPA Sbjct: 328 KLLNINLILPIALELLLDCGKTPPPGFKCPA 358