BLASTX nr result
ID: Glycyrrhiza32_contig00001698
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00001698 (571 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [J... 122 2e-32 YP_009040365.1 hypothetical protein [Hyoscyamus niger] AGU46513.... 61 6e-14 YP_004891653.1 unnamed protein product (chloroplast) [Nicotiana ... 61 6e-14 XP_002888391.1 hypothetical protein ARALYDRAFT_894061 [Arabidops... 66 3e-11 YP_004891654.1 unnamed protein product (chloroplast) [Nicotiana ... 56 4e-11 CDY45543.1 BnaCnng13020D [Brassica napus] CDY19675.1 BnaC09g2931... 65 4e-10 CDY72580.1 BnaCnng78410D, partial [Brassica napus] 48 5e-10 AKF01116.1 hypothetical chloroplast RF15 (chloroplast) [Bactris ... 61 5e-09 AKF01040.1 hypothetical chloroplast RF15 (chloroplast) [Attalea ... 60 1e-08 YP_001109573.1 hypothetical protein Poptr_cp096 [Populus trichoc... 55 3e-07 >YP_002720156.1 ORF126 [Jatropha curcas] YP_002720173.1 ORF126 [Jatropha curcas] ACN72735.1 ORF126 (chloroplast) [Jatropha curcas] ACN72751.1 ORF126 (chloroplast) [Jatropha curcas] Length = 126 Score = 122 bits (305), Expect = 2e-32 Identities = 62/92 (67%), Positives = 68/92 (73%), Gaps = 1/92 (1%) Frame = -1 Query: 457 PPPICFNRNHTGVD*YDTIETSVKMPNHKPTDKVHYIVRFRDWRLTHSMPLVPDIPPHGY 278 PP ICFNRN+T V DTIETS KMP PTDKVHYIVRFRDWRLTHS+ L D+P + Sbjct: 15 PPSICFNRNYTRV--VDTIETSGKMPARNPTDKVHYIVRFRDWRLTHSVTLALDVPKRKW 72 Query: 277 -SRGRVNSIIDAC*HSNLSSPFRAYPKRKRIL 185 GRVNSIID C HS+L SPFRAYPK +L Sbjct: 73 VLSGRVNSIIDVCWHSSLPSPFRAYPKENPVL 104 >YP_009040365.1 hypothetical protein [Hyoscyamus niger] AGU46513.1 hypothetical protein (plastid) [Hyoscyamus niger] Length = 115 Score = 60.8 bits (146), Expect(2) = 6e-14 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 3/36 (8%) Frame = -2 Query: 543 NWNKFGSGSKNIGDLLYLMNGESVLKSSA---PPLY 445 NWNKFGSGS+N+GDLLYLMNGES LKSSA PP Y Sbjct: 24 NWNKFGSGSRNLGDLLYLMNGESALKSSALHPPPEY 59 Score = 43.9 bits (102), Expect(2) = 6e-14 Identities = 26/56 (46%), Positives = 31/56 (55%) Frame = -3 Query: 458 PPPYMLQQKSHRGRLI*YNRNLC*NAQP*TNG*STLHSPF*GLATYPFNAFGTRHS 291 PP YMLQQ+SH+GRL + P N +H GLATYPF+ FGT S Sbjct: 56 PPEYMLQQESHKGRLETSGK------MPARNPADKVHYIVEGLATYPFSDFGTGRS 105 >YP_004891653.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891682.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA77388.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77405.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46700.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46730.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48049.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48079.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95591.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95639.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95701.1 hypothetical protein [synthetic construct] AEO95747.1 hypothetical protein [synthetic construct] prf||1211235CC ORF 115 Length = 115 Score = 60.8 bits (146), Expect(2) = 6e-14 Identities = 29/36 (80%), Positives = 31/36 (86%), Gaps = 3/36 (8%) Frame = -2 Query: 543 NWNKFGSGSKNIGDLLYLMNGESVLKSSA---PPLY 445 NWNKFGSGS+N+GDLLYLMNGES LKSSA PP Y Sbjct: 24 NWNKFGSGSRNLGDLLYLMNGESALKSSALHPPPEY 59 Score = 43.9 bits (102), Expect(2) = 6e-14 Identities = 26/56 (46%), Positives = 31/56 (55%) Frame = -3 Query: 458 PPPYMLQQKSHRGRLI*YNRNLC*NAQP*TNG*STLHSPF*GLATYPFNAFGTRHS 291 PP YMLQQ+SH+GRL + P N +H GLATYPF+ FGT S Sbjct: 56 PPEYMLQQESHKGRLETSGK------MPARNPADKVHYIVQGLATYPFSDFGTGRS 105 >XP_002888391.1 hypothetical protein ARALYDRAFT_894061 [Arabidopsis lyrata subsp. lyrata] EFH64650.1 hypothetical protein ARALYDRAFT_894061 [Arabidopsis lyrata subsp. lyrata] Length = 70 Score = 65.9 bits (159), Expect = 3e-11 Identities = 34/48 (70%), Positives = 39/48 (81%), Gaps = 4/48 (8%) Frame = -2 Query: 552 LLLNWNKFGSGSKNIGDLLYLMNGE--SVLKSSA--PPLYASTEITQG 421 ++L WNKFGSGS+N+GDLLYLMNGE S LKSSA P +Y ST ITQG Sbjct: 23 IILKWNKFGSGSRNLGDLLYLMNGEGKSALKSSALRPAVYDSTRITQG 70 >YP_004891654.1 unnamed protein product (chloroplast) [Nicotiana undulata] YP_004891683.1 unnamed protein product (chloroplast) [Nicotiana undulata] CAA77387.1 hypothetical protein (chloroplast) [Nicotiana tabacum] CAA77406.1 hypothetical protein (chloroplast) [Nicotiana tabacum] BAE46701.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE46731.1 hypothetical protein (chloroplast) [Nicotiana sylvestris] BAE48050.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] BAE48080.1 hypothetical protein (chloroplast) [Nicotiana tomentosiformis] AEO95592.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95640.1 hypothetical protein (chloroplast) [Nicotiana undulata] AEO95702.1 hypothetical protein [synthetic construct] AEO95748.1 hypothetical protein [synthetic construct] prf||1211235CD ORF 92 Length = 92 Score = 56.2 bits (134), Expect(2) = 4e-11 Identities = 27/41 (65%), Positives = 30/41 (73%) Frame = +3 Query: 423 PV*FLLKHIGGGQTISKRTLHSLDREDHQYFLIRCRTYSNS 545 PV + +G G+TI KRT HSLDREDHQ F IRCR YSNS Sbjct: 34 PVEAYTRGVGAGRTILKRTPHSLDREDHQDFAIRCRIYSNS 74 Score = 38.9 bits (89), Expect(2) = 4e-11 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +1 Query: 331 NP*NGLCNVLYPLVYGWAF*QRFLLYHINLPL 426 +P GLCNVLY L YG AF QRFL+Y +P+ Sbjct: 4 SPIPGLCNVLYLLGYGRAFYQRFLIYPCVIPV 35 >CDY45543.1 BnaCnng13020D [Brassica napus] CDY19675.1 BnaC09g29310D [Brassica napus] CDX95211.1 BnaC09g16590D [Brassica napus] Length = 148 Score = 65.1 bits (157), Expect = 4e-10 Identities = 34/48 (70%), Positives = 39/48 (81%), Gaps = 4/48 (8%) Frame = -2 Query: 552 LLLNWNKFGSGSKNIGDLLYLMN--GESVLKSSA--PPLYASTEITQG 421 ++L WNKFGSGS+N+GDLLYLMN GES LKSSA P +Y ST ITQG Sbjct: 36 IILKWNKFGSGSRNLGDLLYLMNGEGESALKSSALRPAVYDSTGITQG 83 Score = 48.1 bits (113), Expect(2) = 5e-10 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -3 Query: 197 KENSVLIGHEYLNRTNHSADLFASEQNN 114 K+N VL+G EYLNR NHS D+F SEQNN Sbjct: 121 KQNPVLLGREYLNRANHSVDIFTSEQNN 148 Score = 43.1 bits (100), Expect(2) = 5e-10 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -1 Query: 271 GRVNSIIDAC*HSNLSSPFRAYPKRKRIL 185 GRVNSIIDA HS+L SPFR YPK+ +L Sbjct: 98 GRVNSIIDAWRHSSLPSPFRTYPKQNPVL 126 >CDY72580.1 BnaCnng78410D, partial [Brassica napus] Length = 74 Score = 48.1 bits (113), Expect(2) = 5e-10 Identities = 20/28 (71%), Positives = 23/28 (82%) Frame = -3 Query: 197 KENSVLIGHEYLNRTNHSADLFASEQNN 114 K+N VL+G EYLNR NHS D+F SEQNN Sbjct: 47 KQNPVLLGREYLNRANHSVDIFTSEQNN 74 Score = 43.1 bits (100), Expect(2) = 5e-10 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -1 Query: 271 GRVNSIIDAC*HSNLSSPFRAYPKRKRIL 185 GRVNSIIDA HS+L SPFR YPK+ +L Sbjct: 24 GRVNSIIDAWRHSSLPSPFRTYPKQNPVL 52 >AKF01116.1 hypothetical chloroplast RF15 (chloroplast) [Bactris major] AKF01189.1 hypothetical chloroplast RF15 (chloroplast) [Beccariophoenix madagascariensis] AKF01208.1 hypothetical chloroplast RF15 (chloroplast) [Beccariophoenix madagascariensis] Length = 107 Score = 61.2 bits (147), Expect = 5e-09 Identities = 47/113 (41%), Positives = 57/113 (50%), Gaps = 10/113 (8%) Frame = +2 Query: 95 LIEPNSNCFVLKQRDPRSGLFYSDIHDQ*VQNSLSFRIGPERRGKVGMSTGV-YY*IHPT 271 + EPNSNCFV KQR PR + I + + FRIGPERR K GM T V + P Sbjct: 1 MTEPNSNCFVPKQRYPRRPVRPIQIFTT-KRYWILFRIGPERRRKAGMPTDVCLFSNSPD 59 Query: 272 PRVPMGGNVWYQRH*MGKSPIPKTDYV-------MYFIRWFM--VGHFNRGFY 403 P VP+ +G S T++V MYFI W M G+F RGFY Sbjct: 60 PIVPI----------LGTSSAKVTEWVSRQSLKRMYFICWVMGTSGYFTRGFY 102 >AKF01040.1 hypothetical chloroplast RF15 (chloroplast) [Attalea speciosa] AOX12842.1 hypothetical chloroplast RF15 (chloroplast) [Cocos nucifera] AOX12863.1 hypothetical chloroplast RF15 (chloroplast) [Cocos nucifera] Length = 107 Score = 60.1 bits (144), Expect = 1e-08 Identities = 46/113 (40%), Positives = 57/113 (50%), Gaps = 10/113 (8%) Frame = +2 Query: 95 LIEPNSNCFVLKQRDPRSGLFYSDIHDQ*VQNSLSFRIGPERRGKVGMSTGV-YY*IHPT 271 + EPNSNCFV KQR PR + I + + FRIGPERR + GM T V + P Sbjct: 1 MTEPNSNCFVPKQRYPRRPVRPIQIFTT-KRYWILFRIGPERRRRAGMPTDVCLFSNSPD 59 Query: 272 PRVPMGGNVWYQRH*MGKSPIPKTDYV-------MYFIRWFM--VGHFNRGFY 403 P VP+ +G S T++V MYFI W M G+F RGFY Sbjct: 60 PIVPI----------LGTSSAKVTEWVSRQSLKRMYFICWVMGTSGYFTRGFY 102 >YP_001109573.1 hypothetical protein Poptr_cp096 [Populus trichocarpa] ABO36777.1 conserved hypothetical protein (chloroplast) [Populus trichocarpa] Length = 71 Score = 55.5 bits (132), Expect = 3e-07 Identities = 29/50 (58%), Positives = 33/50 (66%), Gaps = 6/50 (12%) Frame = -2 Query: 555 DLLLNWNKFGSGSKNIGDLLYLMNG------ESVLKSSAPPLYASTEITQ 424 DLLLNWNKFG GS+N+GDLLYLMN E V + P +ST ITQ Sbjct: 21 DLLLNWNKFGRGSRNLGDLLYLMNNEWGVCFEIVRPGTTPESMSSTGITQ 70