BLASTX nr result
ID: Glycyrrhiza32_contig00001687
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00001687 (223 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015886144.1 PREDICTED: 12-oxophytodienoate reductase 2-like [... 80 9e-18 BAD06520.1 hypothetical protein [Pisum sativum] BAD12188.1 12-ox... 84 2e-17 XP_015886212.1 PREDICTED: 12-oxophytodienoate reductase 2-like, ... 83 4e-17 XP_008339185.1 PREDICTED: 12-oxophytodienoate reductase 2-like [... 82 6e-17 JAU92767.1 12-oxophytodienoate reductase 2, partial [Noccaea cae... 78 9e-17 XP_010245029.1 PREDICTED: putative 12-oxophytodienoate reductase... 82 9e-17 XP_008219067.1 PREDICTED: 12-oxophytodienoate reductase 2-like [... 81 2e-16 XP_007223334.1 hypothetical protein PRUPE_ppa007381mg [Prunus pe... 81 2e-16 XP_009379104.1 PREDICTED: 12-oxophytodienoate reductase 2-like [... 81 2e-16 XP_008357589.1 PREDICTED: 12-oxophytodienoate reductase 2-like [... 81 2e-16 XP_017407993.1 PREDICTED: putative 12-oxophytodienoate reductase... 81 2e-16 JAU53638.1 12-oxophytodienoate reductase 1, partial [Noccaea cae... 75 3e-16 BAI63591.1 12-oxophytodienoate reductase [Lotus japonicus] 80 3e-16 XP_009362373.1 PREDICTED: putative 12-oxophytodienoate reductase... 80 3e-16 ACR77749.2 12-oxophytodienoic acid 10,10-reductase, partial [Ast... 80 3e-16 XP_007020161.2 PREDICTED: putative 12-oxophytodienoate reductase... 80 5e-16 EOY17386.1 12-oxophytodienoate reductase 2 [Theobroma cacao] 80 5e-16 OMO75078.1 hypothetical protein CCACVL1_16326 [Corchorus capsula... 80 6e-16 XP_003610769.1 12-oxophytodienoate reductase-like protein [Medic... 80 6e-16 GAV75959.1 Oxidored_FMN domain-containing protein [Cephalotus fo... 80 6e-16 >XP_015886144.1 PREDICTED: 12-oxophytodienoate reductase 2-like [Ziziphus jujuba] Length = 123 Score = 80.1 bits (196), Expect = 9e-18 Identities = 34/39 (87%), Positives = 38/39 (97%) Frame = -3 Query: 119 DSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 DS+PLLTPYK+GNFNLSHR++LAPLTRQRSY NVPQPHA Sbjct: 3 DSIPLLTPYKLGNFNLSHRIILAPLTRQRSYGNVPQPHA 41 >BAD06520.1 hypothetical protein [Pisum sativum] BAD12188.1 12-oxophytodienoic acid 10, 11-reductase [Pisum sativum] Length = 368 Score = 84.0 bits (206), Expect = 2e-17 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -3 Query: 143 QSLQMAAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 + ++M+A D +PL+TPYKMGNFNLSHRVVLAPLTR RSYNNVPQPHA Sbjct: 4 KKVEMSAADPIPLVTPYKMGNFNLSHRVVLAPLTRTRSYNNVPQPHA 50 >XP_015886212.1 PREDICTED: 12-oxophytodienoate reductase 2-like, partial [Ziziphus jujuba] Length = 432 Score = 83.2 bits (204), Expect = 4e-17 Identities = 41/75 (54%), Positives = 54/75 (72%), Gaps = 2/75 (2%) Frame = -3 Query: 221 CGYHIFA-SPCYSVS*ILLINGYHIAQQS-LQMAAPDSVPLLTPYKMGNFNLSHRVVLAP 48 C Y+I+ SP + + I ++ ++ Q+ DS+PLLTPYK+GNFNLSHR++LAP Sbjct: 33 CAYYIYPLSPSFHLQKIHKLSEEEKEEKKDTQIKMADSIPLLTPYKLGNFNLSHRIILAP 92 Query: 47 LTRQRSYNNVPQPHA 3 LTRQRSY NVPQPHA Sbjct: 93 LTRQRSYGNVPQPHA 107 >XP_008339185.1 PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica] Length = 369 Score = 82.4 bits (202), Expect = 6e-17 Identities = 35/42 (83%), Positives = 40/42 (95%) Frame = -3 Query: 128 AAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 A P ++PLLTPYK+GNFNLSHR++LAPLTRQRSYNNVPQPHA Sbjct: 5 AQPPTIPLLTPYKLGNFNLSHRIILAPLTRQRSYNNVPQPHA 46 >JAU92767.1 12-oxophytodienoate reductase 2, partial [Noccaea caerulescens] Length = 128 Score = 77.8 bits (190), Expect = 9e-17 Identities = 36/38 (94%), Positives = 36/38 (94%) Frame = -3 Query: 116 SVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 SVPLLTPYKMG FNLSHRVVLAPLTRQRSY NVPQPHA Sbjct: 40 SVPLLTPYKMGRFNLSHRVVLAPLTRQRSYGNVPQPHA 77 >XP_010245029.1 PREDICTED: putative 12-oxophytodienoate reductase 11 [Nelumbo nucifera] Length = 383 Score = 82.0 bits (201), Expect = 9e-17 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = -3 Query: 146 QQSLQMAAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 Q Q+ A +PLLTPYKMGNF LSHRVVLAPLTRQRSYNNVPQPHA Sbjct: 10 QNGEQLTAETPIPLLTPYKMGNFGLSHRVVLAPLTRQRSYNNVPQPHA 57 >XP_008219067.1 PREDICTED: 12-oxophytodienoate reductase 2-like [Prunus mume] Length = 370 Score = 81.3 bits (199), Expect = 2e-16 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 128 AAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 A P ++PLLTPYKMG FNLSHR+VLAPLTRQRSYNN+PQPHA Sbjct: 3 AQPPTIPLLTPYKMGKFNLSHRIVLAPLTRQRSYNNIPQPHA 44 >XP_007223334.1 hypothetical protein PRUPE_ppa007381mg [Prunus persica] ONI35662.1 hypothetical protein PRUPE_1G548600 [Prunus persica] Length = 370 Score = 81.3 bits (199), Expect = 2e-16 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -3 Query: 128 AAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 A P ++PLLTPYKMG FNLSHR+VLAPLTRQRSYNN+PQPHA Sbjct: 3 AQPPTIPLLTPYKMGKFNLSHRIVLAPLTRQRSYNNIPQPHA 44 >XP_009379104.1 PREDICTED: 12-oxophytodienoate reductase 2-like [Pyrus x bretschneideri] Length = 372 Score = 81.3 bits (199), Expect = 2e-16 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -3 Query: 125 APDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 AP ++PLLTPYK+GNF+LSHR+VLAPLTRQRSYNNVPQPHA Sbjct: 6 APPTIPLLTPYKLGNFDLSHRIVLAPLTRQRSYNNVPQPHA 46 >XP_008357589.1 PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica] XP_008365261.1 PREDICTED: 12-oxophytodienoate reductase 2-like [Malus domestica] Length = 372 Score = 81.3 bits (199), Expect = 2e-16 Identities = 35/41 (85%), Positives = 40/41 (97%) Frame = -3 Query: 125 APDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 AP ++PLLTPYK+GNF+LSHR+VLAPLTRQRSYNNVPQPHA Sbjct: 6 APPTIPLLTPYKLGNFDLSHRIVLAPLTRQRSYNNVPQPHA 46 >XP_017407993.1 PREDICTED: putative 12-oxophytodienoate reductase 11 [Vigna angularis] KOM27596.1 hypothetical protein LR48_Vigan442s003200 [Vigna angularis] BAU00761.1 hypothetical protein VIGAN_10238100 [Vigna angularis var. angularis] Length = 378 Score = 80.9 bits (198), Expect = 2e-16 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 4/47 (8%) Frame = -3 Query: 131 MAAP----DSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 MAAP S PL+TPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA Sbjct: 1 MAAPATSHQSNPLITPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 47 >JAU53638.1 12-oxophytodienoate reductase 1, partial [Noccaea caerulescens] Length = 81 Score = 75.1 bits (183), Expect = 3e-16 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = -3 Query: 116 SVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 S+PLLTPYKMG FNLSHRVVLAPLTR RSY NVPQPHA Sbjct: 15 SIPLLTPYKMGRFNLSHRVVLAPLTRTRSYGNVPQPHA 52 >BAI63591.1 12-oxophytodienoate reductase [Lotus japonicus] Length = 356 Score = 80.5 bits (197), Expect = 3e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = -3 Query: 131 MAAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 MA P++ PLLTPYKMGNFNLSHR+VLAPLTRQRSYNNVPQPHA Sbjct: 1 MADPNN-PLLTPYKMGNFNLSHRIVLAPLTRQRSYNNVPQPHA 42 >XP_009362373.1 PREDICTED: putative 12-oxophytodienoate reductase 11 [Pyrus x bretschneideri] Length = 376 Score = 80.5 bits (197), Expect = 3e-16 Identities = 34/42 (80%), Positives = 40/42 (95%) Frame = -3 Query: 128 AAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 A P ++PL+TPYK+GNFNLSHR+VLAPLTR+RSYNNVPQPHA Sbjct: 5 AQPPTIPLITPYKLGNFNLSHRIVLAPLTRRRSYNNVPQPHA 46 >ACR77749.2 12-oxophytodienoic acid 10,10-reductase, partial [Astragalus sinicus] Length = 378 Score = 80.5 bits (197), Expect = 3e-16 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 6/51 (11%) Frame = -3 Query: 137 LQMAAP------DSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 +QMAA D +PLLTPYKMGNFNLSHRVVLAPLTR RSYNNVPQPHA Sbjct: 10 IQMAAANINNVVDPIPLLTPYKMGNFNLSHRVVLAPLTRLRSYNNVPQPHA 60 >XP_007020161.2 PREDICTED: putative 12-oxophytodienoate reductase 11 [Theobroma cacao] Length = 383 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 116 SVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 S+PLLTPYK+GNFNLSHRVVLAPLTRQRSYNNVPQPHA Sbjct: 20 SLPLLTPYKLGNFNLSHRVVLAPLTRQRSYNNVPQPHA 57 >EOY17386.1 12-oxophytodienoate reductase 2 [Theobroma cacao] Length = 383 Score = 80.1 bits (196), Expect = 5e-16 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 116 SVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 S+PLLTPYK+GNFNLSHRVVLAPLTRQRSYNNVPQPHA Sbjct: 20 SLPLLTPYKLGNFNLSHRVVLAPLTRQRSYNNVPQPHA 57 >OMO75078.1 hypothetical protein CCACVL1_16326 [Corchorus capsularis] Length = 362 Score = 79.7 bits (195), Expect = 6e-16 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -3 Query: 131 MAAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 MAAP ++PLL+PYKMG FNLSHRVV+ PLTR RSYNNVPQPHA Sbjct: 1 MAAPTTIPLLSPYKMGKFNLSHRVVMPPLTRSRSYNNVPQPHA 43 >XP_003610769.1 12-oxophytodienoate reductase-like protein [Medicago truncatula] AES93727.1 12-oxophytodienoate reductase-like protein [Medicago truncatula] Length = 369 Score = 79.7 bits (195), Expect = 6e-16 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -3 Query: 119 DSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 DS+PLLTPYKMG FNLSHRVVLAPLTRQRSY NVPQPHA Sbjct: 8 DSIPLLTPYKMGKFNLSHRVVLAPLTRQRSYGNVPQPHA 46 >GAV75959.1 Oxidored_FMN domain-containing protein [Cephalotus follicularis] Length = 373 Score = 79.7 bits (195), Expect = 6e-16 Identities = 37/50 (74%), Positives = 41/50 (82%) Frame = -3 Query: 152 IAQQSLQMAAPDSVPLLTPYKMGNFNLSHRVVLAPLTRQRSYNNVPQPHA 3 +A Q + + +PLLTPYKMGNFNLSHRVVLAPLTRQRSY NVPQPHA Sbjct: 1 MASQLEHIGNTNKIPLLTPYKMGNFNLSHRVVLAPLTRQRSYGNVPQPHA 50