BLASTX nr result
ID: Glycyrrhiza32_contig00001632
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00001632 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_062314225.1 hypothetical protein [Bradyrhizobium sp. CCH10-C7] 71 1e-14 SDK31655.1 hypothetical protein SAMN05428983_4544 [Rhizobium sp.... 52 3e-07 WP_047525430.1 hypothetical protein [Rhizobium tropici] 52 3e-07 WP_047470066.1 hypothetical protein [Agrobacterium rhizogenes] 51 1e-06 WP_047478851.1 MULTISPECIES: hypothetical protein [Rhizobium/Agr... 51 1e-06 WP_034482468.1 hypothetical protein [Agrobacterium rhizogenes] 51 1e-06 WP_024271555.1 hypothetical protein [Shinella sp. DD12] EYR77652... 50 2e-06 WP_006472605.1 hypothetical protein [Ochrobactrum intermedium] E... 50 2e-06 WP_037222459.1 MULTISPECIES: hypothetical protein [Rhizobium/Agr... 49 5e-06 >WP_062314225.1 hypothetical protein [Bradyrhizobium sp. CCH10-C7] Length = 80 Score = 71.2 bits (173), Expect = 1e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV Sbjct: 18 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 51 >SDK31655.1 hypothetical protein SAMN05428983_4544 [Rhizobium sp. PDC82] Length = 80 Score = 52.4 bits (124), Expect = 3e-07 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 YMFL+ PG STK+KCL+ SVL+AL TALWC V Sbjct: 18 YMFLTKPGNLLSTKLKCLVCSVLIALFTALWCIV 51 >WP_047525430.1 hypothetical protein [Rhizobium tropici] Length = 82 Score = 52.4 bits (124), Expect = 3e-07 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 YMFL+ PG STK+KCL+ SVL+AL TALWC V Sbjct: 20 YMFLTKPGNLLSTKLKCLVCSVLIALFTALWCIV 53 >WP_047470066.1 hypothetical protein [Agrobacterium rhizogenes] Length = 80 Score = 50.8 bits (120), Expect = 1e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 YMFL+ PGK ST ++CL+ SVL+AL TALWC V Sbjct: 18 YMFLTKPGKLLSTNLQCLVCSVLIALFTALWCIV 51 >WP_047478851.1 MULTISPECIES: hypothetical protein [Rhizobium/Agrobacterium group] Length = 82 Score = 50.8 bits (120), Expect = 1e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 YMFL+ PGK ST ++CL+ SVL+AL TALWC V Sbjct: 20 YMFLTKPGKLLSTNLQCLVCSVLIALFTALWCIV 53 >WP_034482468.1 hypothetical protein [Agrobacterium rhizogenes] Length = 82 Score = 50.8 bits (120), Expect = 1e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 YMFL+ PGK ST ++CL+ SVL+AL TALWC V Sbjct: 20 YMFLTKPGKLLSTNLQCLVCSVLIALFTALWCIV 53 >WP_024271555.1 hypothetical protein [Shinella sp. DD12] EYR77652.1 hypothetical protein SHLA_65c000050 [Shinella sp. DD12] Length = 80 Score = 50.4 bits (119), Expect = 2e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 Y+F+S GKR S +VKCLI SVLVAL+ ALWC + Sbjct: 18 YLFMSQRGKRLSWRVKCLILSVLVALLAALWCVI 51 >WP_006472605.1 hypothetical protein [Ochrobactrum intermedium] ELT47503.1 hypothetical protein D584_19663 [Ochrobactrum intermedium M86] Length = 80 Score = 50.4 bits (119), Expect = 2e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 Y+F+S GKR S +VKCLI SVLVAL+ ALWC V Sbjct: 18 YLFMSQRGKRLSWRVKCLILSVLVALLAALWCIV 51 >WP_037222459.1 MULTISPECIES: hypothetical protein [Rhizobium/Agrobacterium group] OCJ04075.1 hypothetical protein A6U85_27255 [Agrobacterium sp. 13-626] Length = 82 Score = 49.3 bits (116), Expect = 5e-06 Identities = 22/34 (64%), Positives = 26/34 (76%) Frame = +3 Query: 117 YMFLSVPGKRASTKVKCLIFSVLVALMTALWCAV 218 YMFL+ P STK+KCL+ SVL+AL TALWC V Sbjct: 20 YMFLTKPRNLLSTKLKCLVCSVLIALFTALWCIV 53