BLASTX nr result
ID: Glycyrrhiza32_contig00001598
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00001598 (213 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU20268.1 unknown [Glycine max] 70 2e-12 KYP61237.1 hypothetical protein KK1_023666 [Cajanus cajan] 70 2e-12 XP_006585074.1 PREDICTED: protein OBERON 3-like isoform X2 [Glyc... 70 2e-12 KHN12477.1 Protein OBERON 3 [Glycine soja] 70 2e-12 XP_003531140.1 PREDICTED: protein OBERON 3-like isoform X1 [Glyc... 70 2e-12 XP_003524851.1 PREDICTED: protein OBERON 3-like [Glycine max] KH... 70 2e-12 XP_004504583.1 PREDICTED: protein OBERON 3 [Cicer arietinum] 70 3e-12 BAT74270.1 hypothetical protein VIGAN_01190100 [Vigna angularis ... 69 7e-12 XP_014509595.1 PREDICTED: protein OBERON 3-like [Vigna radiata v... 69 7e-12 XP_017442841.1 PREDICTED: protein OBERON 3 [Vigna angularis] KOM... 69 7e-12 XP_007158790.1 hypothetical protein PHAVU_002G182200g [Phaseolus... 69 7e-12 XP_016191199.1 PREDICTED: protein OBERON 3 [Arachis ipaensis] 67 2e-11 XP_015957904.1 PREDICTED: protein OBERON 3 [Arachis duranensis] 67 2e-11 GAU34665.1 hypothetical protein TSUD_67150 [Trifolium subterraneum] 65 2e-10 XP_019448327.1 PREDICTED: protein OBERON 3-like isoform X2 [Lupi... 60 9e-09 XP_019448318.1 PREDICTED: protein OBERON 3-like isoform X1 [Lupi... 60 9e-09 XP_019463905.1 PREDICTED: protein OBERON 3-like [Lupinus angusti... 59 2e-08 XP_002315843.2 hypothetical protein POPTR_0010s11320g [Populus t... 58 4e-08 OIW18070.1 hypothetical protein TanjilG_19302 [Lupinus angustifo... 56 5e-08 XP_015895349.1 PREDICTED: protein OBERON 3 [Ziziphus jujuba] 57 6e-08 >ACU20268.1 unknown [Glycine max] Length = 387 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQDEIDGLL+R+EATKQQW Sbjct: 351 LKVLENSYFDYYKMKKRMQDEIDGLLRRMEATKQQW 386 >KYP61237.1 hypothetical protein KK1_023666 [Cajanus cajan] Length = 478 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQDEIDGLL+R+EATKQQW Sbjct: 442 LKVLENSYFDYYKMKKRMQDEIDGLLRRMEATKQQW 477 >XP_006585074.1 PREDICTED: protein OBERON 3-like isoform X2 [Glycine max] KRH42517.1 hypothetical protein GLYMA_08G094100 [Glycine max] Length = 773 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQDEIDGLL+R+EATKQQW Sbjct: 737 LKVLENSYFDYYKMKKRMQDEIDGLLRRMEATKQQW 772 >KHN12477.1 Protein OBERON 3 [Glycine soja] Length = 794 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQDEIDGLL+R+EATKQQW Sbjct: 758 LKVLENSYFDYYKMKKRMQDEIDGLLRRMEATKQQW 793 >XP_003531140.1 PREDICTED: protein OBERON 3-like isoform X1 [Glycine max] KRH42518.1 hypothetical protein GLYMA_08G094100 [Glycine max] Length = 794 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQDEIDGLL+R+EATKQQW Sbjct: 758 LKVLENSYFDYYKMKKRMQDEIDGLLRRMEATKQQW 793 >XP_003524851.1 PREDICTED: protein OBERON 3-like [Glycine max] KHN25982.1 Protein OBERON 3 [Glycine soja] KRH58611.1 hypothetical protein GLYMA_05G138900 [Glycine max] Length = 817 Score = 70.1 bits (170), Expect = 2e-12 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQDEIDGLL+R+EATKQQW Sbjct: 781 LKVLENSYFDYYKMKKRMQDEIDGLLRRMEATKQQW 816 >XP_004504583.1 PREDICTED: protein OBERON 3 [Cicer arietinum] Length = 801 Score = 69.7 bits (169), Expect = 3e-12 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KV++ SYFDYYKMKKRMQDEIDGLLQR+EATKQQW Sbjct: 765 LKVVEHSYFDYYKMKKRMQDEIDGLLQRMEATKQQW 800 >BAT74270.1 hypothetical protein VIGAN_01190100 [Vigna angularis var. angularis] Length = 805 Score = 68.6 bits (166), Expect = 7e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQ+EIDGLL+R+EATKQQW Sbjct: 769 LKVLENSYFDYYKMKKRMQEEIDGLLRRMEATKQQW 804 >XP_014509595.1 PREDICTED: protein OBERON 3-like [Vigna radiata var. radiata] Length = 805 Score = 68.6 bits (166), Expect = 7e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQ+EIDGLL+R+EATKQQW Sbjct: 769 LKVLENSYFDYYKMKKRMQEEIDGLLRRMEATKQQW 804 >XP_017442841.1 PREDICTED: protein OBERON 3 [Vigna angularis] KOM25051.1 hypothetical protein LR48_Vigan46s001300 [Vigna angularis] Length = 805 Score = 68.6 bits (166), Expect = 7e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQ+EIDGLL+R+EATKQQW Sbjct: 769 LKVLENSYFDYYKMKKRMQEEIDGLLRRMEATKQQW 804 >XP_007158790.1 hypothetical protein PHAVU_002G182200g [Phaseolus vulgaris] ESW30784.1 hypothetical protein PHAVU_002G182200g [Phaseolus vulgaris] Length = 805 Score = 68.6 bits (166), Expect = 7e-12 Identities = 30/36 (83%), Positives = 36/36 (100%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++SYFDYYKMKKRMQ+EIDGLL+R+EATKQQW Sbjct: 769 LKVLENSYFDYYKMKKRMQEEIDGLLRRMEATKQQW 804 >XP_016191199.1 PREDICTED: protein OBERON 3 [Arachis ipaensis] Length = 820 Score = 67.0 bits (162), Expect = 2e-11 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL+ S++DYYKMKKRMQDEIDGLL+R+EATKQQW Sbjct: 784 LKVLEGSHYDYYKMKKRMQDEIDGLLERMEATKQQW 819 >XP_015957904.1 PREDICTED: protein OBERON 3 [Arachis duranensis] Length = 820 Score = 67.0 bits (162), Expect = 2e-11 Identities = 29/36 (80%), Positives = 35/36 (97%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL+ S++DYYKMKKRMQDEIDGLL+R+EATKQQW Sbjct: 784 LKVLEGSHYDYYKMKKRMQDEIDGLLERMEATKQQW 819 >GAU34665.1 hypothetical protein TSUD_67150 [Trifolium subterraneum] Length = 795 Score = 64.7 bits (156), Expect = 2e-10 Identities = 28/36 (77%), Positives = 34/36 (94%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KV+++SY DY+KMKKRMQDEIDGLLQR+EATKQ W Sbjct: 759 LKVVENSYIDYFKMKKRMQDEIDGLLQRMEATKQHW 794 >XP_019448327.1 PREDICTED: protein OBERON 3-like isoform X2 [Lupinus angustifolius] Length = 761 Score = 59.7 bits (143), Expect = 9e-09 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL+ +++DYYKMK RMQDEI GLL+R+EATKQQW Sbjct: 725 LKVLEINHYDYYKMKMRMQDEIAGLLERMEATKQQW 760 >XP_019448318.1 PREDICTED: protein OBERON 3-like isoform X1 [Lupinus angustifolius] OIW18913.1 hypothetical protein TanjilG_25356 [Lupinus angustifolius] Length = 772 Score = 59.7 bits (143), Expect = 9e-09 Identities = 26/36 (72%), Positives = 33/36 (91%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL+ +++DYYKMK RMQDEI GLL+R+EATKQQW Sbjct: 736 LKVLEINHYDYYKMKMRMQDEIAGLLERMEATKQQW 771 >XP_019463905.1 PREDICTED: protein OBERON 3-like [Lupinus angustifolius] OIW00739.1 hypothetical protein TanjilG_09708 [Lupinus angustifolius] Length = 807 Score = 58.5 bits (140), Expect = 2e-08 Identities = 25/36 (69%), Positives = 33/36 (91%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++S++DYYKMK RMQDEI GLL+R+EATK+ W Sbjct: 771 LKVLENSHYDYYKMKMRMQDEIAGLLERMEATKRHW 806 >XP_002315843.2 hypothetical protein POPTR_0010s11320g [Populus trichocarpa] EEF02014.2 hypothetical protein POPTR_0010s11320g [Populus trichocarpa] Length = 764 Score = 57.8 bits (138), Expect = 4e-08 Identities = 24/36 (66%), Positives = 33/36 (91%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +K L++++ DYY MK+RMQ+EIDGLL+R+EATKQQW Sbjct: 728 LKALENTHCDYYNMKQRMQEEIDGLLERMEATKQQW 763 >OIW18070.1 hypothetical protein TanjilG_19302 [Lupinus angustifolius] Length = 177 Score = 56.2 bits (134), Expect = 5e-08 Identities = 25/34 (73%), Positives = 32/34 (94%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQ 123 +KVL++S++DYYKMK RMQDEI GLL+R+EATKQ Sbjct: 144 LKVLENSHYDYYKMKMRMQDEITGLLERMEATKQ 177 >XP_015895349.1 PREDICTED: protein OBERON 3 [Ziziphus jujuba] Length = 831 Score = 57.4 bits (137), Expect = 6e-08 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = +1 Query: 22 VKVLKSSYFDYYKMKKRMQDEIDGLLQRIEATKQQW 129 +KVL++S+ DYY MKKRMQ EI GLL+R+EATKQQW Sbjct: 795 LKVLENSHDDYYNMKKRMQVEISGLLERMEATKQQW 830