BLASTX nr result
ID: Glycyrrhiza32_contig00001353
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00001353 (888 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013447645.1 Nodule Cysteine-Rich (NCR) secreted peptide [Medi... 63 6e-09 >XP_013447645.1 Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula] KEH21726.1 Nodule Cysteine-Rich (NCR) secreted peptide [Medicago truncatula] Length = 120 Score = 63.2 bits (152), Expect = 6e-09 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 3/58 (5%) Frame = +1 Query: 352 SRMLASNDMQIAPRALNGGIQAPDCPPITMYTASTCLNSKQINHNRPCVPTNR---YC 516 SRMLA+ND Q+ P+ N G Q+P+C P ++ +S+CL S Q+N RPC P NR YC Sbjct: 62 SRMLATNDNQVTPQTENSGQQSPNCQPNSLQGSSSCLASPQLNQGRPCEPLNRAYPYC 119