BLASTX nr result
ID: Glycyrrhiza32_contig00001057
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00001057 (485 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019450100.1 PREDICTED: ribosomal RNA small subunit methyltran... 205 9e-63 XP_016176023.1 PREDICTED: ribosomal RNA small subunit methyltran... 204 2e-62 XP_015941027.1 PREDICTED: ribosomal RNA small subunit methyltran... 204 2e-62 XP_019453530.1 PREDICTED: ribosomal RNA small subunit methyltran... 202 2e-61 KYP59438.1 putative dimethyladenosine transferase [Cajanus cajan] 195 3e-59 ACU18732.1 unknown [Glycine max] 192 2e-58 NP_001242880.2 probable dimethyladenosine transferase-like [Glyc... 192 8e-58 KHN44950.1 Putative dimethyladenosine transferase [Glycine soja] 191 2e-57 XP_003542423.1 PREDICTED: ribosomal RNA small subunit methyltran... 191 2e-57 ACJ84909.1 unknown, partial [Medicago truncatula] 187 3e-57 KHN26450.1 Putative dimethyladenosine transferase [Glycine soja] 191 3e-57 GAU27540.1 hypothetical protein TSUD_29720 [Trifolium subterraneum] 191 4e-57 KRH56294.1 hypothetical protein GLYMA_06G315500 [Glycine max] 191 5e-57 XP_017429077.1 PREDICTED: ribosomal RNA small subunit methyltran... 190 9e-57 XP_014503632.1 PREDICTED: ribosomal RNA small subunit methyltran... 190 9e-57 XP_017183276.1 PREDICTED: ribosomal RNA small subunit methyltran... 188 3e-56 XP_009339780.1 PREDICTED: ribosomal RNA small subunit methyltran... 188 3e-56 XP_009378710.1 PREDICTED: ribosomal RNA small subunit methyltran... 188 3e-56 XP_008386722.1 PREDICTED: ribosomal RNA small subunit methyltran... 188 3e-56 XP_007141035.1 hypothetical protein PHAVU_008G161800g [Phaseolus... 188 3e-56 >XP_019450100.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Lupinus angustifolius] OIW08110.1 hypothetical protein TanjilG_06653 [Lupinus angustifolius] Length = 353 Score = 205 bits (522), Expect = 9e-63 Identities = 102/104 (98%), Positives = 103/104 (99%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGKIKKEKGK QQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDV+LEIGP Sbjct: 1 MAGGKIKKEKGKTQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVVLEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV Sbjct: 61 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 104 >XP_016176023.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Arachis ipaensis] XP_016176024.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Arachis ipaensis] XP_016176025.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Arachis ipaensis] XP_016176026.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Arachis ipaensis] Length = 352 Score = 204 bits (520), Expect = 2e-62 Identities = 101/104 (97%), Positives = 102/104 (98%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK+KKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVD IVQKSGIK TDVILEIGP Sbjct: 1 MAGGKVKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDAIVQKSGIKPTDVILEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV Sbjct: 61 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 104 >XP_015941027.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Arachis duranensis] XP_015941028.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Arachis duranensis] Length = 352 Score = 204 bits (520), Expect = 2e-62 Identities = 101/104 (97%), Positives = 102/104 (98%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK+KKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVD IVQKSGIK TDVILEIGP Sbjct: 1 MAGGKVKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDAIVQKSGIKPTDVILEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV Sbjct: 61 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 104 >XP_019453530.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Lupinus angustifolius] OIW06140.1 hypothetical protein TanjilG_22362 [Lupinus angustifolius] Length = 350 Score = 202 bits (513), Expect = 2e-61 Identities = 100/104 (96%), Positives = 102/104 (98%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK+KKEK K QQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDV+LEIGP Sbjct: 1 MAGGKMKKEKSKAQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVVLEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV Sbjct: 61 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 104 >KYP59438.1 putative dimethyladenosine transferase [Cajanus cajan] Length = 309 Score = 195 bits (495), Expect = 3e-59 Identities = 98/105 (93%), Positives = 102/105 (97%), Gaps = 1/105 (0%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQ-HTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIG 136 MAGGK KKEKGKPQQ H PYQGGISFHKSKGQHILKNPLLVD+IVQK+G+KSTDVILEIG Sbjct: 1 MAGGKAKKEKGKPQQQHMPYQGGISFHKSKGQHILKNPLLVDSIVQKAGVKSTDVILEIG 60 Query: 135 PGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 PGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 PGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPHSNRLTV 105 >ACU18732.1 unknown [Glycine max] Length = 308 Score = 192 bits (489), Expect = 2e-58 Identities = 95/107 (88%), Positives = 103/107 (96%), Gaps = 3/107 (2%) Frame = -3 Query: 312 MAGGKIKKEKGKP---QQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILE 142 MAGGK+KKEKGKP Q+H PYQGGISFHKSKGQHILKNPLLVD+IV+K+G+KSTDVILE Sbjct: 1 MAGGKVKKEKGKPHQQQKHMPYQGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILE 60 Query: 141 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 IGPGTGNLTKKLLEAGKKVIA+EIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 IGPGTGNLTKKLLEAGKKVIAIEIDPRMVLELQRRFQGTPHSNRLTV 107 >NP_001242880.2 probable dimethyladenosine transferase-like [Glycine max] XP_006581055.1 PREDICTED: uncharacterized protein LOC100819707 isoform X1 [Glycine max] XP_014631665.1 PREDICTED: uncharacterized protein LOC100819707 isoform X1 [Glycine max] XP_014631666.1 PREDICTED: uncharacterized protein LOC100819707 isoform X1 [Glycine max] KRH56305.1 hypothetical protein GLYMA_06G316500 [Glycine max] Length = 352 Score = 192 bits (489), Expect = 8e-58 Identities = 95/107 (88%), Positives = 103/107 (96%), Gaps = 3/107 (2%) Frame = -3 Query: 312 MAGGKIKKEKGKP---QQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILE 142 MAGGK+KKEKGKP Q+H PYQGGISFHKSKGQHILKNPLLVD+IV+K+G+KSTDVILE Sbjct: 1 MAGGKVKKEKGKPHQQQKHMPYQGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILE 60 Query: 141 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 IGPGTGNLTKKLLEAGKKVIA+EIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 IGPGTGNLTKKLLEAGKKVIAIEIDPRMVLELQRRFQGTPHSNRLTV 107 >KHN44950.1 Putative dimethyladenosine transferase [Glycine soja] Length = 352 Score = 191 bits (486), Expect = 2e-57 Identities = 96/107 (89%), Positives = 102/107 (95%), Gaps = 3/107 (2%) Frame = -3 Query: 312 MAGGKIKKEKGKP---QQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILE 142 MAGGK KKEKGKP Q+H PYQGGISFHKSKGQHILKNPLLVD+IV+K+G+KSTDVILE Sbjct: 1 MAGGKAKKEKGKPHQQQKHMPYQGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILE 60 Query: 141 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPHSNRLTV 107 >XP_003542423.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Glycine max] KRH56295.1 hypothetical protein GLYMA_06G315500 [Glycine max] Length = 352 Score = 191 bits (486), Expect = 2e-57 Identities = 96/107 (89%), Positives = 102/107 (95%), Gaps = 3/107 (2%) Frame = -3 Query: 312 MAGGKIKKEKGKP---QQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILE 142 MAGGK KKEKGKP Q+H PYQGGISFHKSKGQHILKNPLLVD+IV+K+G+KSTDVILE Sbjct: 1 MAGGKAKKEKGKPHQQQKHMPYQGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILE 60 Query: 141 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPHSNRLTV 107 >ACJ84909.1 unknown, partial [Medicago truncatula] Length = 225 Score = 187 bits (475), Expect = 3e-57 Identities = 96/105 (91%), Positives = 101/105 (96%), Gaps = 1/105 (0%) Frame = -3 Query: 312 MAGGKIKKEKGKPQ-QHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIG 136 MAGGKI+KEKGKP QHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIK+TDV+LEIG Sbjct: 1 MAGGKIRKEKGKPSSQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKTTDVVLEIG 60 Query: 135 PGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 PGTGNLTKKLLEAGKKVIAVEIDPRMVLEL +RFQGTP S+RLTV Sbjct: 61 PGTGNLTKKLLEAGKKVIAVEIDPRMVLELNKRFQGTP-SSRLTV 104 >KHN26450.1 Putative dimethyladenosine transferase [Glycine soja] Length = 352 Score = 191 bits (485), Expect = 3e-57 Identities = 95/107 (88%), Positives = 102/107 (95%), Gaps = 3/107 (2%) Frame = -3 Query: 312 MAGGKIKKEKGKP---QQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILE 142 MAGGK KKEKGKP Q+H PYQGGISFHKSKGQHILKNPLLVD+IV+K+G+KSTDVILE Sbjct: 1 MAGGKAKKEKGKPHQQQKHMPYQGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILE 60 Query: 141 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 IGPGTGNLTKKLLEAGKKVIA+EIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 IGPGTGNLTKKLLEAGKKVIAIEIDPRMVLELQRRFQGTPHSNRLTV 107 >GAU27540.1 hypothetical protein TSUD_29720 [Trifolium subterraneum] Length = 342 Score = 191 bits (484), Expect = 4e-57 Identities = 96/104 (92%), Positives = 100/104 (96%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGKIKKEKGKP QHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIK TDV+LEIGP Sbjct: 1 MAGGKIKKEKGKPSQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKPTDVVLEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLL+AGKKVIAVEIDPRMVLELQ+RFQGTP S+RL V Sbjct: 61 GTGNLTKKLLDAGKKVIAVEIDPRMVLELQKRFQGTP-SSRLMV 103 >KRH56294.1 hypothetical protein GLYMA_06G315500 [Glycine max] Length = 380 Score = 191 bits (486), Expect = 5e-57 Identities = 96/107 (89%), Positives = 102/107 (95%), Gaps = 3/107 (2%) Frame = -3 Query: 312 MAGGKIKKEKGKP---QQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILE 142 MAGGK KKEKGKP Q+H PYQGGISFHKSKGQHILKNPLLVD+IV+K+G+KSTDVILE Sbjct: 1 MAGGKAKKEKGKPHQQQKHMPYQGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILE 60 Query: 141 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 IGPGTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPHSNRLTV 107 >XP_017429077.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Vigna angularis] BAT82040.1 hypothetical protein VIGAN_03198100 [Vigna angularis var. angularis] Length = 349 Score = 190 bits (482), Expect = 9e-57 Identities = 94/104 (90%), Positives = 98/104 (94%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK KKEK K QQH PYQGGISFHKSKGQHILKNPLLVD+IVQKSG+K TDV+LEIGP Sbjct: 1 MAGGKAKKEKTKAQQHMPYQGGISFHKSKGQHILKNPLLVDSIVQKSGVKPTDVVLEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEA KKVIAVEIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 GTGNLTKKLLEAAKKVIAVEIDPRMVLELQRRFQGTPHSNRLTV 104 >XP_014503632.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Vigna radiata var. radiata] Length = 349 Score = 190 bits (482), Expect = 9e-57 Identities = 94/104 (90%), Positives = 98/104 (94%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK KKEK K QQH PYQGGISFHKSKGQHILKNPLLVD+IVQKSG+K TDV+LEIGP Sbjct: 1 MAGGKAKKEKTKAQQHMPYQGGISFHKSKGQHILKNPLLVDSIVQKSGVKPTDVVLEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEA KKVIAVEIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 GTGNLTKKLLEAAKKVIAVEIDPRMVLELQRRFQGTPHSNRLTV 104 >XP_017183276.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Malus domestica] Length = 345 Score = 188 bits (478), Expect = 3e-56 Identities = 94/104 (90%), Positives = 98/104 (94%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK KKEK +P HTPYQGGISFHKSKGQHILKNPLLVD+IVQKSGIKSTDVILEIGP Sbjct: 1 MAGGKTKKEKARPAGHTPYQGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEAGK+VIAVEID RMVLELQRRFQGTP+SNRL V Sbjct: 61 GTGNLTKKLLEAGKRVIAVEIDARMVLELQRRFQGTPHSNRLQV 104 >XP_009339780.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Pyrus x bretschneideri] Length = 345 Score = 188 bits (478), Expect = 3e-56 Identities = 94/104 (90%), Positives = 98/104 (94%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK KKEK +P HTPYQGGISFHKSKGQHILKNPLLVD+IVQKSGIKSTDVILEIGP Sbjct: 1 MAGGKAKKEKARPAGHTPYQGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEAGK+VIAVEID RMVLELQRRFQGTP+SNRL V Sbjct: 61 GTGNLTKKLLEAGKRVIAVEIDARMVLELQRRFQGTPHSNRLQV 104 >XP_009378710.1 PREDICTED: ribosomal RNA small subunit methyltransferase [Pyrus x bretschneideri] Length = 345 Score = 188 bits (478), Expect = 3e-56 Identities = 94/104 (90%), Positives = 98/104 (94%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK KKEK +P HTPYQGGISFHKSKGQHILKNPLLVD+IVQKSGIKSTDVILEIGP Sbjct: 1 MAGGKTKKEKARPAGHTPYQGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEAGK+VIAVEID RMVLELQRRFQGTP+SNRL V Sbjct: 61 GTGNLTKKLLEAGKRVIAVEIDARMVLELQRRFQGTPHSNRLQV 104 >XP_008386722.1 PREDICTED: ribosomal RNA small subunit methyltransferase-like [Malus domestica] Length = 345 Score = 188 bits (478), Expect = 3e-56 Identities = 94/104 (90%), Positives = 98/104 (94%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK KKEK +P HTPYQGGISFHKSKGQHILKNPLLVD+IVQKSGIKSTDVILEIGP Sbjct: 1 MAGGKAKKEKARPAGHTPYQGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEAGK+VIAVEID RMVLELQRRFQGTP+SNRL V Sbjct: 61 GTGNLTKKLLEAGKRVIAVEIDARMVLELQRRFQGTPHSNRLQV 104 >XP_007141035.1 hypothetical protein PHAVU_008G161800g [Phaseolus vulgaris] ESW13029.1 hypothetical protein PHAVU_008G161800g [Phaseolus vulgaris] Length = 349 Score = 188 bits (478), Expect = 3e-56 Identities = 93/104 (89%), Positives = 97/104 (93%) Frame = -3 Query: 312 MAGGKIKKEKGKPQQHTPYQGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGP 133 MAGGK KKEK K QH PYQGGISFHKSKGQHILKNPLLVD+IVQKSG+K TDV+LEIGP Sbjct: 1 MAGGKAKKEKAKAPQHMPYQGGISFHKSKGQHILKNPLLVDSIVQKSGVKPTDVVLEIGP 60 Query: 132 GTGNLTKKLLEAGKKVIAVEIDPRMVLELQRRFQGTPYSNRLTV 1 GTGNLTKKLLEA KKVIAVEIDPRMVLELQRRFQGTP+SNRLTV Sbjct: 61 GTGNLTKKLLEAAKKVIAVEIDPRMVLELQRRFQGTPHSNRLTV 104