BLASTX nr result
ID: Glycyrrhiza32_contig00000569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00000569 (333 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP69218.1 Pentatricopeptide repeat-containing protein At5g08305... 72 1e-12 KYP69134.1 Pentatricopeptide repeat-containing protein At5g08305... 72 2e-12 XP_004517144.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 4e-12 XP_004495472.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 4e-12 XP_004495469.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 5e-12 XP_004495476.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 5e-12 KRH36124.1 hypothetical protein GLYMA_10G284800 [Glycine max] 70 1e-11 KHN37372.1 Sugar transport protein 11 [Glycine soja] 70 1e-11 XP_014618921.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 70 1e-11 XP_003555200.1 PREDICTED: pentatricopeptide repeat-containing pr... 70 1e-11 KHN23095.1 Pentatricopeptide repeat-containing protein [Glycine ... 68 5e-11 XP_017412788.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 8e-11 XP_014512263.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 8e-11 XP_017412786.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 8e-11 XP_003592711.1 PPR containing plant-like protein [Medicago trunc... 66 3e-10 OAY33050.1 hypothetical protein MANES_13G065600 [Manihot esculenta] 65 4e-10 XP_015942084.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 5e-10 XP_015942082.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 5e-10 KZN09934.1 hypothetical protein DCAR_002590 [Daucus carota subsp... 65 7e-10 XP_017242649.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 7e-10 >KYP69218.1 Pentatricopeptide repeat-containing protein At5g08305 family [Cajanus cajan] Length = 294 Score = 71.6 bits (174), Expect = 1e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMPIEPTASMLGALLSGCINHRNL LAEI Sbjct: 146 LTTAYQFICQMPIEPTASMLGALLSGCINHRNLALAEI 183 >KYP69134.1 Pentatricopeptide repeat-containing protein At5g08305 family [Cajanus cajan] Length = 391 Score = 71.6 bits (174), Expect = 2e-12 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMPIEPTASMLGALLSGCINHRNL LAEI Sbjct: 243 LTTAYQFICQMPIEPTASMLGALLSGCINHRNLALAEI 280 >XP_004517144.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like, partial [Cicer arietinum] Length = 391 Score = 70.9 bits (172), Expect = 4e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMPIEPTA MLGALLSGCINHRNL+LAEI Sbjct: 330 LTAAYQFICQMPIEPTAPMLGALLSGCINHRNLDLAEI 367 >XP_004495472.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like isoform X2 [Cicer arietinum] Length = 445 Score = 70.9 bits (172), Expect = 4e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMPIEPTA MLGALLSGCINHRNL+LAEI Sbjct: 296 LTAAYQFICQMPIEPTAPMLGALLSGCINHRNLDLAEI 333 >XP_004495469.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like isoform X1 [Cicer arietinum] XP_004495470.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like isoform X1 [Cicer arietinum] XP_004495471.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like isoform X1 [Cicer arietinum] Length = 549 Score = 70.9 bits (172), Expect = 5e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMPIEPTA MLGALLSGCINHRNL+LAEI Sbjct: 400 LTAAYQFICQMPIEPTAPMLGALLSGCINHRNLDLAEI 437 >XP_004495476.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like [Cicer arietinum] Length = 557 Score = 70.9 bits (172), Expect = 5e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMPIEPTA MLGALLSGCINHRNL+LAEI Sbjct: 400 LTAAYQFICQMPIEPTAPMLGALLSGCINHRNLDLAEI 437 >KRH36124.1 hypothetical protein GLYMA_10G284800 [Glycine max] Length = 439 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMP EPTASMLGALLSGCINHRNL LAEI Sbjct: 292 LTTAYQFICQMPTEPTASMLGALLSGCINHRNLALAEI 329 >KHN37372.1 Sugar transport protein 11 [Glycine soja] Length = 532 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMP EPTASMLGALLSGCINHRNL LAEI Sbjct: 385 LTTAYQFICQMPTEPTASMLGALLSGCINHRNLALAEI 422 >XP_014618921.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g08305 [Glycine max] Length = 547 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMP EPTASMLGALLSGCINHRNL LAEI Sbjct: 400 LTTAYQFICQMPTEPTASMLGALLSGCINHRNLALAEI 437 >XP_003555200.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305-like [Glycine max] KRG90630.1 hypothetical protein GLYMA_20G104500 [Glycine max] Length = 548 Score = 69.7 bits (169), Expect = 1e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMP EPTASMLGALLSGCINHRNL LAEI Sbjct: 400 LTTAYQFICQMPTEPTASMLGALLSGCINHRNLALAEI 437 >KHN23095.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 444 Score = 67.8 bits (164), Expect = 5e-11 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 + +YQFICQMP EPTA MLGALLSGCINHRNL LAEI Sbjct: 296 LTTAYQFICQMPTEPTAPMLGALLSGCINHRNLALAEI 333 >XP_017412788.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 isoform X2 [Vigna angularis] Length = 492 Score = 67.4 bits (163), Expect = 8e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAE 329 + +YQFIC+MPIEPTA+MLGALLSGCINHRNL LAE Sbjct: 342 LTTAYQFICRMPIEPTAAMLGALLSGCINHRNLALAE 378 >XP_014512263.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 [Vigna radiata var. radiata] XP_014512264.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 [Vigna radiata var. radiata] Length = 550 Score = 67.4 bits (163), Expect = 8e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAE 329 + +YQFIC+MPIEPTA+MLGALLSGCINHRNL LAE Sbjct: 400 LTTAYQFICRMPIEPTAAMLGALLSGCINHRNLTLAE 436 >XP_017412786.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 isoform X1 [Vigna angularis] XP_017412787.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 isoform X1 [Vigna angularis] KOM36430.1 hypothetical protein LR48_Vigan02g258000 [Vigna angularis] BAT93657.1 hypothetical protein VIGAN_08018000 [Vigna angularis var. angularis] Length = 550 Score = 67.4 bits (163), Expect = 8e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAE 329 + +YQFIC+MPIEPTA+MLGALLSGCINHRNL LAE Sbjct: 400 LTTAYQFICRMPIEPTAAMLGALLSGCINHRNLALAE 436 >XP_003592711.1 PPR containing plant-like protein [Medicago truncatula] AES62962.1 PPR containing plant-like protein [Medicago truncatula] Length = 550 Score = 65.9 bits (159), Expect = 3e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAE 329 + +YQFICQ+PIEPTASMLGA+ SGCINHRN +LAE Sbjct: 400 LTTAYQFICQIPIEPTASMLGAIFSGCINHRNFDLAE 436 >OAY33050.1 hypothetical protein MANES_13G065600 [Manihot esculenta] Length = 538 Score = 65.5 bits (158), Expect = 4e-10 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +3 Query: 228 SYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 +YQF+CQMPI+PTASMLGALLSGC+NHR +LAEI Sbjct: 403 AYQFLCQMPIQPTASMLGALLSGCMNHRKFDLAEI 437 >XP_015942084.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 isoform X2 [Arachis duranensis] Length = 539 Score = 65.1 bits (157), Expect = 5e-10 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 228 SYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 +YQFICQMP++PTAS+LGALLSGCINHR+ +LAEI Sbjct: 404 AYQFICQMPMQPTASVLGALLSGCINHRDFDLAEI 438 >XP_015942082.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 isoform X1 [Arachis duranensis] XP_015942083.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 isoform X1 [Arachis duranensis] Length = 563 Score = 65.1 bits (157), Expect = 5e-10 Identities = 28/35 (80%), Positives = 34/35 (97%) Frame = +3 Query: 228 SYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 +YQFICQMP++PTAS+LGALLSGCINHR+ +LAEI Sbjct: 428 AYQFICQMPMQPTASVLGALLSGCINHRDFDLAEI 462 >KZN09934.1 hypothetical protein DCAR_002590 [Daucus carota subsp. sativus] Length = 445 Score = 64.7 bits (156), Expect = 7e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 ++ +YQF+CQMP++PTASMLGALLSGCIN+R L+LAEI Sbjct: 296 VDEAYQFLCQMPMQPTASMLGALLSGCINNRKLDLAEI 333 >XP_017242649.1 PREDICTED: pentatricopeptide repeat-containing protein At5g08305 [Daucus carota subsp. sativus] Length = 534 Score = 64.7 bits (156), Expect = 7e-10 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = +3 Query: 219 INLSYQFICQMPIEPTASMLGALLSGCINHRNLELAEI 332 ++ +YQF+CQMP++PTASMLGALLSGCIN+R L+LAEI Sbjct: 390 VDEAYQFLCQMPMQPTASMLGALLSGCINNRKLDLAEI 427