BLASTX nr result
ID: Glycyrrhiza32_contig00000561
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00000561 (296 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN46750.1 hypothetical protein glysoja_015001 [Glycine soja] KR... 56 3e-08 GAU23980.1 hypothetical protein TSUD_327810 [Trifolium subterran... 55 4e-08 XP_007161981.1 hypothetical protein PHAVU_001G114000g [Phaseolus... 55 5e-08 XP_017418159.1 PREDICTED: uncharacterized protein LOC108328783 [... 55 5e-08 XP_003624681.1 hypothetical protein MTR_7g086320 [Medicago trunc... 54 8e-08 ACU23937.1 unknown [Glycine max] 52 9e-07 >KHN46750.1 hypothetical protein glysoja_015001 [Glycine soja] KRH06664.1 hypothetical protein GLYMA_16G038100 [Glycine max] Length = 79 Score = 55.8 bits (133), Expect = 3e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 141 MASLILLFSELVQNNEWDAEALLAAYPPSSF 49 MASL+LLFSELV N+EWDAEALLAAYP S+F Sbjct: 1 MASLVLLFSELVHNHEWDAEALLAAYPSSNF 31 >GAU23980.1 hypothetical protein TSUD_327810 [Trifolium subterraneum] Length = 67 Score = 55.1 bits (131), Expect = 4e-08 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = -3 Query: 141 MASLILLFSELVQNNEWDAEALLAAYPPSS 52 MASLILLFSELV N EWDA ALLAAYPPSS Sbjct: 1 MASLILLFSELVWNQEWDANALLAAYPPSS 30 >XP_007161981.1 hypothetical protein PHAVU_001G114000g [Phaseolus vulgaris] ESW33975.1 hypothetical protein PHAVU_001G114000g [Phaseolus vulgaris] Length = 77 Score = 55.1 bits (131), Expect = 5e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 141 MASLILLFSELVQNNEWDAEALLAAYPPSSF 49 MASL+LLFSELV+N+EWDA ALLAAYPP +F Sbjct: 1 MASLVLLFSELVRNHEWDAAALLAAYPPPNF 31 >XP_017418159.1 PREDICTED: uncharacterized protein LOC108328783 [Vigna angularis] KOM38573.1 hypothetical protein LR48_Vigan03g195500 [Vigna angularis] BAT84958.1 hypothetical protein VIGAN_04244400 [Vigna angularis var. angularis] Length = 80 Score = 55.1 bits (131), Expect = 5e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 141 MASLILLFSELVQNNEWDAEALLAAYPPSSF 49 MASL+LLFSELV+N+EWDA ALLAAYPP +F Sbjct: 1 MASLVLLFSELVRNHEWDAAALLAAYPPPNF 31 >XP_003624681.1 hypothetical protein MTR_7g086320 [Medicago truncatula] AES80899.1 hypothetical protein MTR_7g086320 [Medicago truncatula] Length = 68 Score = 54.3 bits (129), Expect = 8e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 141 MASLILLFSELVQNNEWDAEALLAAYPPSS 52 MASLILLFSELV+N+EW+A ALLAAYPPSS Sbjct: 1 MASLILLFSELVRNHEWNATALLAAYPPSS 30 >ACU23937.1 unknown [Glycine max] Length = 79 Score = 52.0 bits (123), Expect = 9e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -3 Query: 141 MASLILLFSELVQNNEWDAEALLAAYPPSSF 49 MASL+LLFSE V N+EWDAEALLAAYP +F Sbjct: 1 MASLVLLFSEFVHNHEWDAEALLAAYPSFNF 31