BLASTX nr result
ID: Glycyrrhiza32_contig00000493
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00000493 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019414100.1 PREDICTED: protein BOLA4, chloroplastic/mitochond... 55 1e-06 >XP_019414100.1 PREDICTED: protein BOLA4, chloroplastic/mitochondrial [Lupinus angustifolius] OIV98825.1 hypothetical protein TanjilG_08481 [Lupinus angustifolius] Length = 172 Score = 54.7 bits (130), Expect = 1e-06 Identities = 38/65 (58%), Positives = 45/65 (69%), Gaps = 1/65 (1%) Frame = +1 Query: 142 MRPQVFSLSANSTTLLRQALPVLVQ-HKSTLFSTAPNRVSLLRSTPNSINSQTTPLRYNC 318 MR VFSLS N T+LLRQALPVLVQ +K L T+PN + LLRST +INS + N Sbjct: 1 MRSHVFSLSGN-TSLLRQALPVLVQPYKYLLSRTSPNPMLLLRST--AINSHIL-VSSNT 56 Query: 319 GLPKH 333 GLP+H Sbjct: 57 GLPRH 61