BLASTX nr result
ID: Glycyrrhiza32_contig00000462
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza32_contig00000462 (576 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU20258.1 hypothetical protein TSUD_353220 [Trifolium subterran... 83 2e-17 XP_004516996.1 PREDICTED: ATP synthase subunit delta', mitochond... 85 4e-17 GAU20256.1 hypothetical protein TSUD_353210 [Trifolium subterran... 83 2e-16 Q41000.1 RecName: Full=ATP synthase subunit delta', mitochondria... 81 9e-16 XP_003626769.1 F0F1-type ATP synthase, epsilon subunit [Medicago... 80 2e-15 XP_017442550.1 PREDICTED: ATP synthase subunit delta', mitochond... 69 6e-11 XP_014514999.1 PREDICTED: ATP synthase subunit delta', mitochond... 69 6e-11 AFK44473.1 unknown [Lotus japonicus] 67 2e-10 XP_006583520.1 PREDICTED: ATP synthase subunit delta', mitochond... 67 3e-10 XP_006576693.1 PREDICTED: ATP synthase subunit delta', mitochond... 66 4e-10 XP_007134380.1 hypothetical protein PHAVU_010G042900g [Phaseolus... 61 3e-08 XP_019449738.1 PREDICTED: ATP synthase subunit delta', mitochond... 60 6e-08 XP_019449751.1 PREDICTED: ATP synthase subunit delta', mitochond... 59 2e-07 XP_017254423.1 PREDICTED: ATP synthase subunit delta', mitochond... 59 3e-07 XP_019463939.1 PREDICTED: ATP synthase subunit delta', mitochond... 58 4e-07 XP_016174843.1 PREDICTED: ATP synthase subunit delta', mitochond... 58 4e-07 XP_015939351.1 PREDICTED: ATP synthase subunit delta', mitochond... 58 4e-07 XP_010089775.1 ATP synthase subunit delta' [Morus notabilis] EXB... 58 4e-07 XP_015939350.1 PREDICTED: ATP synthase subunit delta', mitochond... 58 5e-07 XP_006375197.1 H+-transporting two-sector ATPase family protein ... 57 1e-06 >GAU20258.1 hypothetical protein TSUD_353220 [Trifolium subterraneum] Length = 104 Score = 83.2 bits (204), Expect = 2e-17 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDVATPAADSSFVEAWKKVSPNLDPPK 3 MFRRATST ++R A+RR STDVATPAADS+F+EAWKKVSPNLDPPK Sbjct: 1 MFRRATSTFLSRTAATRRFSTDVATPAADSAFIEAWKKVSPNLDPPK 47 >XP_004516996.1 PREDICTED: ATP synthase subunit delta', mitochondrial [Cicer arietinum] Length = 197 Score = 84.7 bits (208), Expect = 4e-17 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDVATPAADSSFVEAWKKVSPNLDPPK 3 MFRRATST ++RA ++RR STDVATPAADSSF+EAWKKVSPNLDPPK Sbjct: 1 MFRRATSTFLSRAASTRRFSTDVATPAADSSFIEAWKKVSPNLDPPK 47 >GAU20256.1 hypothetical protein TSUD_353210 [Trifolium subterraneum] Length = 197 Score = 83.2 bits (204), Expect = 2e-16 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDVATPAADSSFVEAWKKVSPNLDPPK 3 MFRRATST ++R A+RR STDVATPAADS+F+EAWKKVSPNLDPPK Sbjct: 1 MFRRATSTFLSRTAATRRFSTDVATPAADSAFIEAWKKVSPNLDPPK 47 >Q41000.1 RecName: Full=ATP synthase subunit delta', mitochondrial; AltName: Full=F-ATPase delta' subunit; Flags: Precursor AAA33646.1 F1-ATPase delta-prime subunit [Pisum sativum] Length = 197 Score = 81.3 bits (199), Expect = 9e-16 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDVATPAADSSFVEAWKKVSPNLDPPK 3 MFRRATST ++RA+A+RR STDVATPA +SSFVEAW+KVSPN+DPPK Sbjct: 1 MFRRATSTFLSRASATRRFSTDVATPATNSSFVEAWRKVSPNIDPPK 47 >XP_003626769.1 F0F1-type ATP synthase, epsilon subunit [Medicago truncatula] AET01245.1 F0F1-type ATP synthase, epsilon subunit [Medicago truncatula] Length = 197 Score = 80.5 bits (197), Expect = 2e-15 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDVATPAADSSFVEAWKKVSPNLDPPK 3 MFRRATS+L +RA A+RR STDVATP DSSFVEAW KVSPNLDPPK Sbjct: 1 MFRRATSSLFSRAVATRRFSTDVATPVTDSSFVEAWNKVSPNLDPPK 47 >XP_017442550.1 PREDICTED: ATP synthase subunit delta', mitochondrial [Vigna angularis] BAT96877.1 hypothetical protein VIGAN_09019000 [Vigna angularis var. angularis] Length = 197 Score = 68.6 bits (166), Expect = 6e-11 Identities = 37/48 (77%), Positives = 42/48 (87%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDV-ATPAADSSFVEAWKKVSPNLDPPK 3 M RRATS L++ A+ RRLSTDV ATP+A+SSFVEAWKKVSPNLDPPK Sbjct: 1 MLRRATSALLSGASR-RRLSTDVPATPSAESSFVEAWKKVSPNLDPPK 47 >XP_014514999.1 PREDICTED: ATP synthase subunit delta', mitochondrial [Vigna radiata var. radiata] Length = 197 Score = 68.6 bits (166), Expect = 6e-11 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDV-ATPAADSSFVEAWKKVSPNLDPPK 3 M RRATS L++ A+ RR STDV ATP+ADSSFVEAWKKVSPNLDPPK Sbjct: 1 MLRRATSALLSGASR-RRFSTDVPATPSADSSFVEAWKKVSPNLDPPK 47 >AFK44473.1 unknown [Lotus japonicus] Length = 199 Score = 67.4 bits (163), Expect = 2e-10 Identities = 36/49 (73%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -2 Query: 143 MFRRATSTLVARATAS-RRLSTDVATPAA-DSSFVEAWKKVSPNLDPPK 3 MFRRATS+LVARA A+ RR STDV PAA S+F +AWKKVSPN+DPPK Sbjct: 1 MFRRATSSLVARAAANTRRFSTDVGAPAAAGSNFEDAWKKVSPNVDPPK 49 >XP_006583520.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Glycine max] KRH48852.1 hypothetical protein GLYMA_07G117000 [Glycine max] Length = 197 Score = 66.6 bits (161), Expect = 3e-10 Identities = 35/48 (72%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDV-ATPAADSSFVEAWKKVSPNLDPPK 3 M RRAT++L++ A+ RRLSTDV ATPAADS F EAWKKVSPN+DPPK Sbjct: 1 MLRRATTSLISGASR-RRLSTDVPATPAADSVFAEAWKKVSPNIDPPK 47 >XP_006576693.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Glycine max] KHN19720.1 ATP synthase subunit delta', mitochondrial [Glycine soja] KRH66417.1 hypothetical protein GLYMA_03G105300 [Glycine max] Length = 197 Score = 66.2 bits (160), Expect = 4e-10 Identities = 35/48 (72%), Positives = 41/48 (85%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDV-ATPAADSSFVEAWKKVSPNLDPPK 3 M RRATS+L+ A+ RRLS+DV ATPAADS+F EAWKKVSPN+DPPK Sbjct: 1 MLRRATSSLLTGASR-RRLSSDVPATPAADSAFAEAWKKVSPNIDPPK 47 >XP_007134380.1 hypothetical protein PHAVU_010G042900g [Phaseolus vulgaris] ESW06374.1 hypothetical protein PHAVU_010G042900g [Phaseolus vulgaris] Length = 197 Score = 61.2 bits (147), Expect = 3e-08 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDV-ATPAADSSFVEAWKKVSPNLDPPK 3 M RRATS+L++ + RRLSTD ATP +SSF EAWKKVSPNL+PPK Sbjct: 1 MLRRATSSLLS-GVSRRRLSTDAPATPVVNSSFAEAWKKVSPNLEPPK 47 >XP_019449738.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Lupinus angustifolius] OIW18838.1 hypothetical protein TanjilG_25281 [Lupinus angustifolius] Length = 201 Score = 60.5 bits (145), Expect = 6e-08 Identities = 32/51 (62%), Positives = 39/51 (76%), Gaps = 4/51 (7%) Frame = -2 Query: 143 MFRRATSTL---VARATASRRLSTDVAT-PAADSSFVEAWKKVSPNLDPPK 3 MFRRAT+ L + A AS+R STD+ PA D+SFVEAWKKVSP++DPPK Sbjct: 1 MFRRATTLLRRPLNAAAASKRFSTDLPVEPATDASFVEAWKKVSPHIDPPK 51 >XP_019449751.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Lupinus angustifolius] OIW18839.1 hypothetical protein TanjilG_25282 [Lupinus angustifolius] Length = 200 Score = 58.9 bits (141), Expect = 2e-07 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 3/50 (6%) Frame = -2 Query: 143 MFRRATSTL--VARATASRRLSTDVATP-AADSSFVEAWKKVSPNLDPPK 3 MFRRAT+ L A AS+R STD+ AAD+SFVEAWKKVSP++DPPK Sbjct: 1 MFRRATTLLRRPLNAAASKRFSTDLPVESAADASFVEAWKKVSPHIDPPK 50 >XP_017254423.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Daucus carota subsp. sativus] KZM90910.1 hypothetical protein DCAR_021725 [Daucus carota subsp. sativus] Length = 200 Score = 58.5 bits (140), Expect = 3e-07 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 3/50 (6%) Frame = -2 Query: 143 MFRRATSTLVARATAS--RRLSTDV-ATPAADSSFVEAWKKVSPNLDPPK 3 MFR AT+ L+AR+ S RR +TD+ A+P D++FVEAWKKV PN+DPPK Sbjct: 1 MFRYATARLLARSAPSGARRFATDLEASPPTDAAFVEAWKKVVPNIDPPK 50 >XP_019463939.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Lupinus angustifolius] OIW00970.1 hypothetical protein TanjilG_16219 [Lupinus angustifolius] Length = 200 Score = 58.2 bits (139), Expect = 4e-07 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = -2 Query: 143 MFRRATSTL--VARATASRRLSTDVATP-AADSSFVEAWKKVSPNLDPPK 3 MFRRAT+ L A ASRR STD+ + AADSSFV+AWKK SP +DPPK Sbjct: 1 MFRRATTLLRRPLNAAASRRFSTDLPSETAADSSFVKAWKKASPTIDPPK 50 >XP_016174843.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Arachis ipaensis] Length = 200 Score = 58.2 bits (139), Expect = 4e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 4/51 (7%) Frame = -2 Query: 143 MFRRATSTLVAR---ATASRRLSTDVATPAA-DSSFVEAWKKVSPNLDPPK 3 MFRRAT TL+ R SRR STD+ A DSSFVEAWKKVSPN+DPPK Sbjct: 1 MFRRAT-TLLRRPLIGATSRRFSTDLPAAAVEDSSFVEAWKKVSPNVDPPK 50 >XP_015939351.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Arachis duranensis] Length = 200 Score = 58.2 bits (139), Expect = 4e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 4/51 (7%) Frame = -2 Query: 143 MFRRATSTLVAR---ATASRRLSTDVATPAA-DSSFVEAWKKVSPNLDPPK 3 MFRRAT TL+ R SRR STD+ A DSSFVEAWKKVSPN+DPPK Sbjct: 1 MFRRAT-TLLRRPLMGATSRRFSTDLPAAAVEDSSFVEAWKKVSPNVDPPK 50 >XP_010089775.1 ATP synthase subunit delta' [Morus notabilis] EXB38367.1 ATP synthase subunit delta' [Morus notabilis] Length = 202 Score = 58.2 bits (139), Expect = 4e-07 Identities = 31/52 (59%), Positives = 38/52 (73%), Gaps = 5/52 (9%) Frame = -2 Query: 143 MFRRATSTLVARATA----SRRLSTDV-ATPAADSSFVEAWKKVSPNLDPPK 3 MFRRAT++L+ RATA +R STDV A DS+F EAWKKV PN++PPK Sbjct: 1 MFRRATTSLLGRATAFSGRARPFSTDVPAAQTGDSAFAEAWKKVIPNIEPPK 52 >XP_015939350.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Arachis duranensis] XP_016174842.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Arachis ipaensis] Length = 200 Score = 57.8 bits (138), Expect = 5e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 4/51 (7%) Frame = -2 Query: 143 MFRRATSTLVAR---ATASRRLSTDVATPAA-DSSFVEAWKKVSPNLDPPK 3 MFRRA STL+ R SRR STD+ A DSSFVEAWKKVSPN+DPPK Sbjct: 1 MFRRA-STLLRRPLMGATSRRFSTDLPAAAVEDSSFVEAWKKVSPNVDPPK 50 >XP_006375197.1 H+-transporting two-sector ATPase family protein [Populus trichocarpa] ERP52994.1 H+-transporting two-sector ATPase family protein [Populus trichocarpa] Length = 198 Score = 57.0 bits (136), Expect = 1e-06 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -2 Query: 143 MFRRATSTLVARATASRRLSTDV-ATPAADSSFVEAWKKVSPNLDPPK 3 MFRRAT+ ++AR +R ST + A DS+F EAWKKV+PNLDPPK Sbjct: 1 MFRRATTGILARTIRARLFSTGLPAAQTIDSTFAEAWKKVAPNLDPPK 48