BLASTX nr result
ID: Glycyrrhiza31_contig00018856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00018856 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013470495.1 macrophage erythroblast attacher-like protein [Me... 108 1e-25 KRG92995.1 hypothetical protein GLYMA_20G242800 [Glycine max] 108 1e-25 KRG92996.1 hypothetical protein GLYMA_20G242800 [Glycine max] 108 2e-25 KYP47070.1 Macrophage erythroblast attacher [Cajanus cajan] 107 4e-25 KHN27082.1 Macrophage erythroblast attacher [Glycine soja] 106 4e-25 XP_003556550.2 PREDICTED: uncharacterized protein LOC100805248 [... 108 5e-25 KHN37306.1 Macrophage erythroblast attacher [Glycine soja] 106 9e-25 XP_003536784.1 PREDICTED: macrophage erythroblast attacher [Glyc... 106 1e-24 KRH36241.1 hypothetical protein GLYMA_10G2927002, partial [Glyci... 106 2e-24 XP_006436159.1 hypothetical protein CICLE_v10031660mg [Citrus cl... 101 6e-24 BAD94564.1 hypothetical protein [Arabidopsis thaliana] 99 7e-24 XP_012570281.1 PREDICTED: macrophage erythroblast attacher [Cice... 103 7e-24 XP_017414785.1 PREDICTED: macrophage erythroblast attacher [Vign... 103 9e-24 BAT93571.1 hypothetical protein VIGAN_08008300 [Vigna angularis ... 103 1e-23 XP_019428745.1 PREDICTED: macrophage erythroblast attacher-like ... 102 2e-23 KDO67852.1 hypothetical protein CISIN_1g014891mg [Citrus sinensis] 101 3e-23 XP_006436161.1 hypothetical protein CICLE_v10031660mg [Citrus cl... 101 3e-23 XP_014513731.1 PREDICTED: protein CLP1 homolog [Vigna radiata va... 103 3e-23 XP_019453489.1 PREDICTED: macrophage erythroblast attacher-like ... 101 5e-23 KDO67853.1 hypothetical protein CISIN_1g014891mg [Citrus sinensis] 101 5e-23 >XP_013470495.1 macrophage erythroblast attacher-like protein [Medicago truncatula] KEH44533.1 macrophage erythroblast attacher-like protein [Medicago truncatula] Length = 415 Score = 108 bits (270), Expect = 1e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS Sbjct: 365 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 415 >KRG92995.1 hypothetical protein GLYMA_20G242800 [Glycine max] Length = 416 Score = 108 bits (270), Expect = 1e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS Sbjct: 366 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 416 >KRG92996.1 hypothetical protein GLYMA_20G242800 [Glycine max] Length = 429 Score = 108 bits (270), Expect = 2e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS Sbjct: 379 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 429 >KYP47070.1 Macrophage erythroblast attacher [Cajanus cajan] Length = 414 Score = 107 bits (267), Expect = 4e-25 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYT+LVKAYIS Sbjct: 364 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTDLVKAYIS 414 >KHN27082.1 Macrophage erythroblast attacher [Glycine soja] Length = 346 Score = 106 bits (264), Expect = 4e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNG IICPRTGLVCSYTELVKAYIS Sbjct: 296 DTENPPQVLPNGYVYSTKALEEMAKKNNGTIICPRTGLVCSYTELVKAYIS 346 >XP_003556550.2 PREDICTED: uncharacterized protein LOC100805248 [Glycine max] Length = 871 Score = 108 bits (270), Expect = 5e-25 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS Sbjct: 821 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 871 >KHN37306.1 Macrophage erythroblast attacher [Glycine soja] Length = 409 Score = 106 bits (264), Expect = 9e-25 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNG IICPRTGLVCSYTELVKAYIS Sbjct: 359 DTENPPQVLPNGYVYSTKALEEMAKKNNGTIICPRTGLVCSYTELVKAYIS 409 >XP_003536784.1 PREDICTED: macrophage erythroblast attacher [Glycine max] Length = 414 Score = 106 bits (264), Expect = 1e-24 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNG IICPRTGLVCSYTELVKAYIS Sbjct: 364 DTENPPQVLPNGYVYSTKALEEMAKKNNGTIICPRTGLVCSYTELVKAYIS 414 >KRH36241.1 hypothetical protein GLYMA_10G2927002, partial [Glycine max] Length = 577 Score = 106 bits (264), Expect = 2e-24 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNG IICPRTGLVCSYTELVKAYIS Sbjct: 527 DTENPPQVLPNGYVYSTKALEEMAKKNNGTIICPRTGLVCSYTELVKAYIS 577 >XP_006436159.1 hypothetical protein CICLE_v10031660mg [Citrus clementina] ESR49399.1 hypothetical protein CICLE_v10031660mg [Citrus clementina] KDO67854.1 hypothetical protein CISIN_1g014891mg [Citrus sinensis] Length = 263 Score = 101 bits (252), Expect = 6e-24 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNG+I CPRTGLVC+Y++LVKAYIS Sbjct: 213 DTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS 263 >BAD94564.1 hypothetical protein [Arabidopsis thaliana] Length = 163 Score = 99.0 bits (245), Expect = 7e-24 Identities = 45/51 (88%), Positives = 49/51 (96%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKAL+EMA+KN G+I CPRTGLVC+YTELVKAYIS Sbjct: 113 DTENPPQVLPNGYVYSTKALKEMAEKNGGKITCPRTGLVCNYTELVKAYIS 163 >XP_012570281.1 PREDICTED: macrophage erythroblast attacher [Cicer arietinum] Length = 415 Score = 103 bits (258), Expect = 7e-24 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKN+GRIICPRTGL CSYTELVKAYIS Sbjct: 365 DTENPPQVLPNGYVYSTKALEEMAKKNDGRIICPRTGLNCSYTELVKAYIS 415 >XP_017414785.1 PREDICTED: macrophage erythroblast attacher [Vigna angularis] KOM36552.1 hypothetical protein LR48_Vigan02g270200 [Vigna angularis] Length = 410 Score = 103 bits (257), Expect = 9e-24 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCS T+LVKAYIS Sbjct: 360 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSDTDLVKAYIS 410 >BAT93571.1 hypothetical protein VIGAN_08008300 [Vigna angularis var. angularis] Length = 451 Score = 103 bits (257), Expect = 1e-23 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCS T+LVKAYIS Sbjct: 401 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSDTDLVKAYIS 451 >XP_019428745.1 PREDICTED: macrophage erythroblast attacher-like [Lupinus angustifolius] Length = 407 Score = 102 bits (255), Expect = 2e-23 Identities = 48/51 (94%), Positives = 49/51 (96%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALE+MAKKNNGRI CPRT LVCSYTELVKAYIS Sbjct: 357 DTENPPQVLPNGYVYSTKALEDMAKKNNGRITCPRTDLVCSYTELVKAYIS 407 >KDO67852.1 hypothetical protein CISIN_1g014891mg [Citrus sinensis] Length = 351 Score = 101 bits (252), Expect = 3e-23 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNG+I CPRTGLVC+Y++LVKAYIS Sbjct: 301 DTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS 351 >XP_006436161.1 hypothetical protein CICLE_v10031660mg [Citrus clementina] XP_006485978.1 PREDICTED: macrophage erythroblast attacher isoform X2 [Citrus sinensis] ESR49401.1 hypothetical protein CICLE_v10031660mg [Citrus clementina] Length = 351 Score = 101 bits (252), Expect = 3e-23 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNG+I CPRTGLVC+Y++LVKAYIS Sbjct: 301 DTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS 351 >XP_014513731.1 PREDICTED: protein CLP1 homolog [Vigna radiata var. radiata] Length = 868 Score = 103 bits (257), Expect = 3e-23 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCS T+LVKAYIS Sbjct: 818 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSDTDLVKAYIS 868 >XP_019453489.1 PREDICTED: macrophage erythroblast attacher-like [Lupinus angustifolius] Length = 408 Score = 101 bits (252), Expect = 5e-23 Identities = 46/51 (90%), Positives = 49/51 (96%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRT VC+YTE++KAYIS Sbjct: 358 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTDFVCNYTEVIKAYIS 408 >KDO67853.1 hypothetical protein CISIN_1g014891mg [Citrus sinensis] Length = 416 Score = 101 bits (252), Expect = 5e-23 Identities = 46/51 (90%), Positives = 50/51 (98%) Frame = -2 Query: 368 DTENPPQVLPNGYVYSTKALEEMAKKNNGRIICPRTGLVCSYTELVKAYIS 216 DTENPPQVLPNGYVYSTKALEEMAKKNNG+I CPRTGLVC+Y++LVKAYIS Sbjct: 366 DTENPPQVLPNGYVYSTKALEEMAKKNNGKITCPRTGLVCNYSDLVKAYIS 416