BLASTX nr result
ID: Glycyrrhiza31_contig00018553
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00018553 (469 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016181012.1 PREDICTED: regulatory-associated protein of TOR 1... 50 7e-08 >XP_016181012.1 PREDICTED: regulatory-associated protein of TOR 1-like [Arachis ipaensis] Length = 193 Score = 49.7 bits (117), Expect(2) = 7e-08 Identities = 21/32 (65%), Positives = 24/32 (75%) Frame = -3 Query: 398 PLNDFIGCLQLRRVHQTSLGSARHVSCCWVIL 303 P DFIGCLQLRRVH T L A +SCCW+I+ Sbjct: 157 PSLDFIGCLQLRRVHDTCLRKAMLISCCWMIM 188 Score = 34.3 bits (77), Expect(2) = 7e-08 Identities = 17/25 (68%), Positives = 18/25 (72%) Frame = -1 Query: 469 VLQMHVYASMPMTTLKQDKSTFFFP 395 VLQMHV SM M TLKQD+ST P Sbjct: 130 VLQMHVSVSMLMKTLKQDESTVVVP 154