BLASTX nr result
ID: Glycyrrhiza31_contig00018549
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00018549 (483 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017191539.1 PREDICTED: RING finger and transmembrane domain-c... 76 2e-14 AQK84958.1 RING/U-box superfamily protein [Zea mays] 75 3e-14 EMT14879.1 Ring finger and transmembrane domain-containing prote... 75 8e-14 KHN40596.1 RING finger and transmembrane domain-containing prote... 76 8e-14 XP_009783875.1 PREDICTED: RING finger and transmembrane domain-c... 75 9e-14 OAO93600.1 hypothetical protein AXX17_AT5G01050 [Arabidopsis tha... 74 9e-14 KHN25789.1 RING finger and transmembrane domain-containing prote... 77 1e-13 XP_015699202.1 PREDICTED: RING finger and transmembrane domain-c... 76 1e-13 XP_007136401.1 hypothetical protein PHAVU_009G041900g [Phaseolus... 77 1e-13 BAT78982.1 hypothetical protein VIGAN_02176000 [Vigna angularis ... 77 1e-13 XP_014501797.1 PREDICTED: RING finger and transmembrane domain-c... 77 1e-13 XP_017422538.1 PREDICTED: RING finger and transmembrane domain-c... 77 1e-13 XP_003523294.1 PREDICTED: RING finger and transmembrane domain-c... 77 1e-13 KYP53774.1 Ring finger and transmembrane domain-containing prote... 77 1e-13 XP_003528012.1 PREDICTED: RING finger and transmembrane domain-c... 77 1e-13 XP_003615464.1 zinc finger, C3HC4 type (RING finger) protein [Me... 77 1e-13 XP_004490513.1 PREDICTED: RING finger and transmembrane domain-c... 77 1e-13 XP_016166326.1 PREDICTED: RING finger and transmembrane domain-c... 77 1e-13 XP_015932192.1 PREDICTED: RING finger and transmembrane domain-c... 77 1e-13 EMS47238.1 RING finger and transmembrane domain-containing prote... 76 2e-13 >XP_017191539.1 PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Malus domestica] Length = 148 Score = 75.9 bits (185), Expect = 2e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLR+FGDGSTSLFFQLF Sbjct: 113 EWFERERTCPLCRALVKPADLRSFGDGSTSLFFQLF 148 >AQK84958.1 RING/U-box superfamily protein [Zea mays] Length = 148 Score = 75.1 bits (183), Expect = 3e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK AD+R+FGDGSTSLFFQLF Sbjct: 113 EWFERERTCPLCRALVKPADIRSFGDGSTSLFFQLF 148 >EMT14879.1 Ring finger and transmembrane domain-containing protein 2 [Aegilops tauschii] Length = 192 Score = 75.1 bits (183), Expect = 8e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK AD+R+FGDGSTSLFFQLF Sbjct: 157 EWFERERTCPLCRALVKPADIRSFGDGSTSLFFQLF 192 >KHN40596.1 RING finger and transmembrane domain-containing protein 2 [Glycine soja] Length = 232 Score = 75.9 bits (185), Expect = 8e-14 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLR+FGDGSTSLFFQLF Sbjct: 197 EWFERERTCPLCRALVKPADLRSFGDGSTSLFFQLF 232 >XP_009783875.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Nicotiana sylvestris] Length = 182 Score = 74.7 bits (182), Expect = 9e-14 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALV+ ADLR+FGDGSTSLFFQLF Sbjct: 147 EWFERERTCPLCRALVRPADLRSFGDGSTSLFFQLF 182 >OAO93600.1 hypothetical protein AXX17_AT5G01050 [Arabidopsis thaliana] Length = 152 Score = 73.9 bits (180), Expect = 9e-14 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADL++FGDGSTSLFFQ+F Sbjct: 117 EWFERERTCPLCRALVKPADLKSFGDGSTSLFFQIF 152 >KHN25789.1 RING finger and transmembrane domain-containing protein 2 [Glycine soja] Length = 407 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 372 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 407 >XP_015699202.1 PREDICTED: RING finger and transmembrane domain-containing protein 2-like [Oryza brachyantha] Length = 251 Score = 75.9 bits (185), Expect = 1e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLR+FGDGSTSLFFQLF Sbjct: 216 EWFERERTCPLCRALVKPADLRSFGDGSTSLFFQLF 251 >XP_007136401.1 hypothetical protein PHAVU_009G041900g [Phaseolus vulgaris] ESW08395.1 hypothetical protein PHAVU_009G041900g [Phaseolus vulgaris] Length = 459 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 424 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 459 >BAT78982.1 hypothetical protein VIGAN_02176000 [Vigna angularis var. angularis] Length = 461 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 426 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 461 >XP_014501797.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Vigna radiata var. radiata] Length = 461 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 426 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 461 >XP_017422538.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Vigna angularis] KOM41013.1 hypothetical protein LR48_Vigan04g121100 [Vigna angularis] Length = 461 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 426 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 461 >XP_003523294.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Glycine max] KRH64237.1 hypothetical protein GLYMA_04G224200 [Glycine max] Length = 464 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 429 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 464 >KYP53774.1 Ring finger and transmembrane domain-containing protein 2 [Cajanus cajan] Length = 465 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 430 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 465 >XP_003528012.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Glycine max] KRH53695.1 hypothetical protein GLYMA_06G140600 [Glycine max] Length = 473 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 438 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 473 >XP_003615464.1 zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] AES98422.1 zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula] Length = 481 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 446 EWFERERTCPLCRALVKAADLRTFGDGSTSLFFQLF 481 >XP_004490513.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Cicer arietinum] XP_012568414.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Cicer arietinum] Length = 502 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 467 EWFERERTCPLCRALVKAADLRTFGDGSTSLFFQLF 502 >XP_016166326.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Arachis ipaensis] Length = 515 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 480 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 515 >XP_015932192.1 PREDICTED: RING finger and transmembrane domain-containing protein 1-like [Arachis duranensis] Length = 515 Score = 77.4 bits (189), Expect = 1e-13 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLRTFGDGSTSLFFQLF Sbjct: 480 EWFERERTCPLCRALVKPADLRTFGDGSTSLFFQLF 515 >EMS47238.1 RING finger and transmembrane domain-containing protein 2 [Triticum urartu] Length = 300 Score = 75.9 bits (185), Expect = 2e-13 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -2 Query: 482 EWFERERTCPLCRALVKQADLRTFGDGSTSLFFQLF 375 EWFERERTCPLCRALVK ADLR+FGDGSTSLFFQLF Sbjct: 265 EWFERERTCPLCRALVKPADLRSFGDGSTSLFFQLF 300