BLASTX nr result
ID: Glycyrrhiza31_contig00018495
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00018495 (300 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY60539.1 hypothetical protein MANES_01G120000 [Manihot esculenta] 116 7e-29 XP_002532530.1 PREDICTED: aspartic proteinase PCS1 [Ricinus comm... 116 1e-28 OIW02651.1 hypothetical protein TanjilG_29427 [Lupinus angustifo... 114 1e-28 XP_019461969.1 PREDICTED: aspartic proteinase PCS1-like [Lupinus... 114 4e-28 OAY57195.1 hypothetical protein MANES_02G078400 [Manihot esculenta] 113 1e-27 XP_004490830.1 PREDICTED: aspartic proteinase PCS1-like [Cicer a... 113 1e-27 XP_010551704.1 PREDICTED: aspartic proteinase PCS1-like [Tarenay... 112 2e-27 XP_003616254.1 eukaryotic aspartyl protease family protein [Medi... 112 2e-27 XP_019236983.1 PREDICTED: aspartic proteinase PCS1-like [Nicotia... 112 4e-27 XP_009763373.1 PREDICTED: aspartic proteinase PCS1-like [Nicotia... 112 4e-27 XP_009609572.1 PREDICTED: aspartic proteinase PCS1-like [Nicotia... 112 4e-27 KHN07536.1 Aspartic proteinase nepenthesin-1 [Glycine soja] 110 5e-27 KHN41056.1 Aspartic proteinase nepenthesin-1 [Glycine soja] 111 7e-27 KHN39476.1 Aspartic proteinase nepenthesin-1 [Glycine soja] 110 8e-27 XP_015956733.1 PREDICTED: aspartic proteinase PCS1 [Arachis dura... 111 8e-27 KRG97956.1 hypothetical protein GLYMA_18G041400 [Glycine max] 110 1e-26 XP_019185452.1 PREDICTED: aspartic proteinase PCS1-like [Ipomoea... 110 1e-26 XP_015881464.1 PREDICTED: aspartic proteinase PCS1 [Ziziphus juj... 110 2e-26 OIW14153.1 hypothetical protein TanjilG_21293 [Lupinus angustifo... 109 2e-26 XP_011085873.1 PREDICTED: aspartic proteinase PCS1 [Sesamum indi... 110 2e-26 >OAY60539.1 hypothetical protein MANES_01G120000 [Manihot esculenta] Length = 438 Score = 116 bits (291), Expect = 7e-29 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+LPIGTPPQ QQMVLDTGSQLSWIQCHN+ PKKPPPTA+FDPSLSSSF VLPCT Sbjct: 76 MALIVSLPIGTPPQTQQMVLDTGSQLSWIQCHNKT-PKKPPPTAAFDPSLSSSFSVLPCT 134 Query: 7 HP 2 HP Sbjct: 135 HP 136 >XP_002532530.1 PREDICTED: aspartic proteinase PCS1 [Ricinus communis] EEF29846.1 Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus communis] Length = 440 Score = 116 bits (290), Expect = 1e-28 Identities = 52/62 (83%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+LPIGTPPQ QQMVLDTGSQLSWIQCH ++ PKKPPPT SFDPSLSSSF VLPC Sbjct: 78 MALIVSLPIGTPPQTQQMVLDTGSQLSWIQCHKKSVPKKPPPTTSFDPSLSSSFSVLPCN 137 Query: 7 HP 2 HP Sbjct: 138 HP 139 >OIW02651.1 hypothetical protein TanjilG_29427 [Lupinus angustifolius] Length = 361 Score = 114 bits (286), Expect = 1e-28 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+LPIGTPPQ+QQMVLDTGSQLSWIQCHN+A PKK PPT SFDPSLSSSF ++PCT Sbjct: 1 MALIVSLPIGTPPQIQQMVLDTGSQLSWIQCHNKA-PKKTPPTTSFDPSLSSSFSIIPCT 59 Query: 7 HP 2 HP Sbjct: 60 HP 61 >XP_019461969.1 PREDICTED: aspartic proteinase PCS1-like [Lupinus angustifolius] Length = 439 Score = 114 bits (286), Expect = 4e-28 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+LPIGTPPQ+QQMVLDTGSQLSWIQCHN+A PKK PPT SFDPSLSSSF ++PCT Sbjct: 79 MALIVSLPIGTPPQIQQMVLDTGSQLSWIQCHNKA-PKKTPPTTSFDPSLSSSFSIIPCT 137 Query: 7 HP 2 HP Sbjct: 138 HP 139 >OAY57195.1 hypothetical protein MANES_02G078400 [Manihot esculenta] Length = 440 Score = 113 bits (283), Expect = 1e-27 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+LPIGTPPQ QQMVLDTGSQLSWIQCH++A PK+PPPT +FDPSLSSSF VLPCT Sbjct: 79 MALIVSLPIGTPPQTQQMVLDTGSQLSWIQCHHKA-PKRPPPTTAFDPSLSSSFSVLPCT 137 Query: 7 HP 2 HP Sbjct: 138 HP 139 >XP_004490830.1 PREDICTED: aspartic proteinase PCS1-like [Cicer arietinum] Length = 435 Score = 113 bits (282), Expect = 1e-27 Identities = 54/62 (87%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHN+ PKK PT SFDPSLSSSF+VLPC Sbjct: 76 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNKT-PKKQQPTTSFDPSLSSSFYVLPCN 134 Query: 7 HP 2 HP Sbjct: 135 HP 136 >XP_010551704.1 PREDICTED: aspartic proteinase PCS1-like [Tarenaya hassleriana] Length = 441 Score = 112 bits (281), Expect = 2e-27 Identities = 50/62 (80%), Positives = 55/62 (88%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+LPIGTPPQ QQMVLDTGSQLSWIQCH + +P PPPT SFDPSLSSSF VLPC+ Sbjct: 78 MALIVSLPIGTPPQTQQMVLDTGSQLSWIQCHRKQRPAPPPPTTSFDPSLSSSFSVLPCS 137 Query: 7 HP 2 HP Sbjct: 138 HP 139 >XP_003616254.1 eukaryotic aspartyl protease family protein [Medicago truncatula] AES99212.1 eukaryotic aspartyl protease family protein [Medicago truncatula] Length = 442 Score = 112 bits (281), Expect = 2e-27 Identities = 54/64 (84%), Positives = 57/64 (89%), Gaps = 2/64 (3%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKP--KKPPPTASFDPSLSSSFHVLP 14 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHN+ P K+PP T+SFDPSLSSSF VLP Sbjct: 80 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNKKTPQKKQPPTTSSFDPSLSSSFFVLP 139 Query: 13 CTHP 2 C HP Sbjct: 140 CNHP 143 >XP_019236983.1 PREDICTED: aspartic proteinase PCS1-like [Nicotiana attenuata] OIT22735.1 aspartic proteinase pcs1 [Nicotiana attenuata] Length = 449 Score = 112 bits (279), Expect = 4e-27 Identities = 52/62 (83%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+VTLPIGTPPQ QQMVLDTGSQLSWIQCH + PK+PPPT SFDPSLSS+F VLPCT Sbjct: 88 MALIVTLPIGTPPQNQQMVLDTGSQLSWIQCHKKI-PKRPPPTTSFDPSLSSTFSVLPCT 146 Query: 7 HP 2 HP Sbjct: 147 HP 148 >XP_009763373.1 PREDICTED: aspartic proteinase PCS1-like [Nicotiana sylvestris] XP_016461515.1 PREDICTED: aspartic proteinase PCS1-like [Nicotiana tabacum] Length = 449 Score = 112 bits (279), Expect = 4e-27 Identities = 52/62 (83%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+VTLPIGTPPQ QQMVLDTGSQLSWIQCH + PK+PPPT SFDPSLSS+F VLPCT Sbjct: 88 MALIVTLPIGTPPQNQQMVLDTGSQLSWIQCHKKI-PKRPPPTTSFDPSLSSTFSVLPCT 146 Query: 7 HP 2 HP Sbjct: 147 HP 148 >XP_009609572.1 PREDICTED: aspartic proteinase PCS1-like [Nicotiana tomentosiformis] XP_016486657.1 PREDICTED: aspartic proteinase PCS1-like [Nicotiana tabacum] Length = 449 Score = 112 bits (279), Expect = 4e-27 Identities = 52/62 (83%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+VTLPIGTPPQ QQMVLDTGSQLSWIQCH + PK+PPPT SFDPSLSS+F VLPCT Sbjct: 88 MALIVTLPIGTPPQNQQMVLDTGSQLSWIQCHKKI-PKRPPPTTSFDPSLSSTFSVLPCT 146 Query: 7 HP 2 HP Sbjct: 147 HP 148 >KHN07536.1 Aspartic proteinase nepenthesin-1 [Glycine soja] Length = 383 Score = 110 bits (276), Expect = 5e-27 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V LPIGTPPQ+Q MVLDTGSQLSWIQCH +A P KPPPTASFDPSLSS+F +LPCT Sbjct: 27 MALIVDLPIGTPPQVQPMVLDTGSQLSWIQCHKKA-PAKPPPTASFDPSLSSTFSILPCT 85 Query: 7 HP 2 HP Sbjct: 86 HP 87 >KHN41056.1 Aspartic proteinase nepenthesin-1 [Glycine soja] Length = 427 Score = 111 bits (277), Expect = 7e-27 Identities = 58/84 (69%), Positives = 60/84 (71%) Frame = -3 Query: 253 PQLRTXXXXXXXXXXXXXXXXSMALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPK 74 P LRT SMALVVTLPIGTPPQ QQMVLDTGSQLSWIQCHN Sbjct: 48 PNLRTLSSSSSSYNIKSSFKYSMALVVTLPIGTPPQHQQMVLDTGSQLSWIQCHN----- 102 Query: 73 KPPPTASFDPSLSSSFHVLPCTHP 2 K PPTASFDPSLSSSF++LPCTHP Sbjct: 103 KTPPTASFDPSLSSSFYILPCTHP 126 >KHN39476.1 Aspartic proteinase nepenthesin-1 [Glycine soja] Length = 359 Score = 110 bits (274), Expect = 8e-27 Identities = 54/62 (87%), Positives = 55/62 (88%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MALVVTLPIGTPPQ QQMVLDTGSQLSWIQCHN K PPTASFDPSLSSSF+VLPCT Sbjct: 1 MALVVTLPIGTPPQPQQMVLDTGSQLSWIQCHN-----KTPPTASFDPSLSSSFYVLPCT 55 Query: 7 HP 2 HP Sbjct: 56 HP 57 >XP_015956733.1 PREDICTED: aspartic proteinase PCS1 [Arachis duranensis] Length = 452 Score = 111 bits (277), Expect = 8e-27 Identities = 51/64 (79%), Positives = 55/64 (85%), Gaps = 2/64 (3%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNR--AKPKKPPPTASFDPSLSSSFHVLP 14 M L+VTLPIGTPPQ QQM+LDTGSQLSWIQCHN+ KP PPPT SFDPSLSS+F VLP Sbjct: 86 MVLIVTLPIGTPPQAQQMILDTGSQLSWIQCHNKKAVKPPPPPPTPSFDPSLSSTFSVLP 145 Query: 13 CTHP 2 CTHP Sbjct: 146 CTHP 149 >KRG97956.1 hypothetical protein GLYMA_18G041400 [Glycine max] Length = 433 Score = 110 bits (276), Expect = 1e-26 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V LPIGTPPQ+Q MVLDTGSQLSWIQCH +A P KPPPTASFDPSLSS+F +LPCT Sbjct: 80 MALIVDLPIGTPPQVQPMVLDTGSQLSWIQCHKKA-PAKPPPTASFDPSLSSTFSILPCT 138 Query: 7 HP 2 HP Sbjct: 139 HP 140 >XP_019185452.1 PREDICTED: aspartic proteinase PCS1-like [Ipomoea nil] Length = 445 Score = 110 bits (276), Expect = 1e-26 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MALVVTLPIGTPPQ QQMVLDTGSQLSWIQC N+ P+KPPPTA+FDPSLSSSF VLPC+ Sbjct: 83 MALVVTLPIGTPPQNQQMVLDTGSQLSWIQC-NKKVPRKPPPTAAFDPSLSSSFSVLPCS 141 Query: 7 HP 2 HP Sbjct: 142 HP 143 >XP_015881464.1 PREDICTED: aspartic proteinase PCS1 [Ziziphus jujuba] Length = 446 Score = 110 bits (275), Expect = 2e-26 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+ PIGTPPQ QQMVLDTGSQLSWIQCH +A P+ PPPTASFDPSLSS+F VLPCT Sbjct: 84 MALIVSFPIGTPPQTQQMVLDTGSQLSWIQCHKKA-PRVPPPTASFDPSLSSTFSVLPCT 142 Query: 7 HP 2 HP Sbjct: 143 HP 144 >OIW14153.1 hypothetical protein TanjilG_21293 [Lupinus angustifolius] Length = 387 Score = 109 bits (273), Expect = 2e-26 Identities = 49/62 (79%), Positives = 55/62 (88%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+LPIGTPPQ+QQMVLDTGSQLSWIQCHN+ K+ PPT SFDPSLSS+F LPCT Sbjct: 23 MALIVSLPIGTPPQIQQMVLDTGSQLSWIQCHNKVPKKQHPPTPSFDPSLSSTFSPLPCT 82 Query: 7 HP 2 HP Sbjct: 83 HP 84 >XP_011085873.1 PREDICTED: aspartic proteinase PCS1 [Sesamum indicum] Length = 457 Score = 110 bits (275), Expect = 2e-26 Identities = 51/62 (82%), Positives = 56/62 (90%) Frame = -3 Query: 187 MALVVTLPIGTPPQLQQMVLDTGSQLSWIQCHNRAKPKKPPPTASFDPSLSSSFHVLPCT 8 MAL+V+LPIGTPPQ QQMVLDTGSQLSWIQCH R P+KPPP++SFDPSLSSSF VLPC Sbjct: 89 MALIVSLPIGTPPQTQQMVLDTGSQLSWIQCH-RKSPRKPPPSSSFDPSLSSSFSVLPCN 147 Query: 7 HP 2 HP Sbjct: 148 HP 149